KEGG   Mus musculus (mouse): 28146
Entry
28146             CDS       T01002                                 

Gene name
Serp1, D3Ucla1, Ramp4
Definition
(RefSeq) stress-associated endoplasmic reticulum protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RAMP4 DUF1206 DUF4079
Other DBs
NCBI-GeneID: 28146
NCBI-ProteinID: NP_109610
MGI: 92638
Ensembl: ENSMUSG00000027808
Vega: OTTMUSG00000029383
UniProt: Q9Z1W5
Position
3 D; 3 28.58 cM
AA seq 66 aa
MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ
SIRMGM
NT seq 201 nt   +upstreamnt  +downstreamnt
atggtcgccaagcagaggatccgtatggccaacgagaagcacagcaagaacataactcag
cgcggcaacgtcgctaagacctcgagaaatgcccccgaagaaaaggcgtcggtaggaccc
tggttattggccctcttcatttttgttgtctgtggctctgcaattttccagattattcaa
agtatcaggatgggcatgtga

DBGET integrated database retrieval system