KEGG   Mus musculus (mouse): 28240Help
Entry
28240             CDS       T01002                                 

Gene name
Trpm2, 9830168K16Rik, C79133, LTRPC2, TRPC7, Trp7, Trrp7
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 2
  KO
K04977  transient receptor potential cation channel subfamily M member 2 [EC:3.6.1.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    28240 (Trpm2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    28240 (Trpm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    28240 (Trpm2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     28240 (Trpm2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   28240 (Trpm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 28240
NCBI-ProteinID: NP_612174
MGI: 1351901
Ensembl: ENSMUSG00000009292
Vega: OTTMUSG00000020526
UniProt: Q91YD4 Q3UYE9
Position
10 C1; 10 39.72 cM
AA seq 1506 aa AA seqDB search
MESLDRRRTGSEQEEGFGVQSRRATDLGMVPNLRRSNSSLCKSRRFLCSFSSEKQENLSS
WIPENIKKKECVYFVESSKLSDAGKVVCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQE
MPTDAFGDIVFTDLSQKVGKYVRVSQDTPSSVIYQLMTQHWGLDVPNLLISVTGGAKNFN
MKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGEVITIGV
ATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPL
RTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVAD
VIAQVATLPVSEITISLIQQKLSIFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTIFRE
GKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKP
ADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLA
EEQRLAYASATPRLHMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSMTVPHIKLNVQGV
SLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKEL
SKEEEDTDSSEEMLALADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLAL
EAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFISFREKRLQALC
RPARVRAFFNAPVVIFHMNILSYFAFLCLFAYVLMVDFQPSPSWCEYLIYLWLFSLVCEE
TRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVGLTCRLIPATLYPGRIILSLDF
IMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRV
DWIFRGVVYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEW
LTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGRPPAPPP
LILLSHLQLLIKRIVLKIPAKRHKQLKNKLEKNEETALLSWELYLKENYLQNQQYQQKQR
PEQKIQDISEKVDTMVDLLDMDQVKRSGSTEQRLASLEEQVTQVTRALHWIVTTLKDSGF
GSGAGALTLAPQRAFDEPDAELSIRRKVEEPGDGYHVSARHLLYPNARIMRFPVPNEKVP
WAAEFLIYDPPFYTAEKDVALTDPVGDTAEPLSKISYNVVDGPTDRRSFHGVYVVEYGFP
LNPMGRTGLRGRGSLSWFGPNHTLQPVVTRWKRNQGGAICRKSVRKMLEVLVMKLPRSEH
WALPGGSREPGEMLPRKLKRVLRQEFWVAFETLLMQGTEVYKGYVDDPRNTDNAWIETVA
VSIHFQDQNDMELKRLEENLHTHDPKELTRDLKLSTEWQVVDRRIPLYANHKTILQKVAS
LFGAHF
NT seq 4521 nt NT seq  +upstreamnt  +downstreamnt
atggagtccttggaccggagaagaactggctctgagcaggaggagggctttggggtgcag
tcaaggagggccactgacctgggcatggtccccaatctccgacgaagcaatagcagcctt
tgcaagagcaggagatttctgtgctctttcagcagtgagaagcaagaaaaccttagctca
tggattcccgagaatatcaagaagaaggagtgtgtgtacttcgtggaaagttccaaactc
tcggacgcagggaaggtagtgtgtgcgtgtggttatacccacgagcaacacttggaggtg
gccatcaagccacacaccttccagggcaaggagtgggatccaaagaaacacgtccaagag
atgcccacagatgcctttggtgacatcgttttcacagacctgagccagaaagtggggaag
tatgtccgggtctcccaggacacgccctccagtgtcatctaccagctcatgacccagcac
tggggcctagatgtccccaacctcctcatctccgtgaccggtggggccaagaacttcaac
atgaagctgaggctgaagagcatcttccggagaggcttggtcaaggtggctcaaaccacg
ggggcctggatcatcactggaggatcccacacaggcgtgatgaagcaggtgggcgaagcg
gtacgggacttcagtctgagcagcagctgcaaagaaggtgaagtcatcactattggcgta
gccacgtggggcaccatccacaaccgcgagggactgatccatcccatgggaggcttcccc
gccgagtacatgctggatgaggaaggccaagggaacctgacctgcttggacagcaaccat
tcccacttcatcttggtggatgatgggacccacgggcaatatggtgtggagattccgctg
aggactaagctggaaaagttcatctcagagcaaacgaaggaaaggggaggtgtggccatc
aagatccccattgtctgcgtggtgttggagggtggccctggcactctgcatacaatctac
aatgccatcaacaatggcacaccctgcgtgatagtggagggctctggccgagtggctgac
gtcatcgctcaggtagctactctgcctgtctctgagatcaccatctccttgatccagcag
aagctcagcatattcttccaggagatgtttgagactttcaccgaaaaccagattgtggaa
tggaccaaaaagatccaagacattgtccggaggcggcagctgctgacgatcttccgggaa
ggcaaggatggtcagcaggatgtggatgtggccattctgcaggcgttactgaaagcctct
cgaagccaagaccactttggccacgagaactgggaccaccaactgaagttggctgtggcc
tggaaccgcgtggacatcgctcgcagtgagatcttcaccgatgaatggcagtggaagcct
gcagatctgcatcccatgatgacggccgctctcatctccaacaagcctgagttcgtgagg
ctctttctggagaatggggtgcggctcaaggagtttgtcacttgggatactcttctctgc
ctgtacgagaacctggagccgtcctgtctcttccacagcaagctacagaaggtgctggcc
gaagaacagcgcttagcctatgcatctgcaacaccccgcctgcacatgcaccatgtggcc
caggtgcttcgtgaactcctgggggactccacgcagctgctgtacccccggccccggtac
actgacaggccacggctctcgatgaccgtgccacacatcaagctgaacgtgcagggagtg
agcctccggtccctctataagcgatcaacaggccacgttaccttcaccattgacccagtc
cgtgaccttctcatttgggccgttatccagaaccacagggagctggcaggcatcatctgg
gctcagagtcaggactgtactgccgcagcactggcctgtagcaagatcctgaaggagctg
tccaaggaggaggaagatacagacagctctgaggagatgctggcactggcagacgagttt
gagcacagagctataggcgtcttcactgagtgctacaggaaggatgaggaaagagcccag
aagctgcttgtccgtgtgtctgaggcctgggggaagaccacctgcctgcagctggcccta
gaggccaaggacatgaaattcgtgtctcatggaggcatccaggctttcctaaccaaggtg
tggtggggccagctctgtgtggacaatggcctgtggaggatcatcctgtgcatgctggcc
ttcccgctgctcttcaccggcttcatctccttcagggaaaagaggctgcaggcactgtgt
cgcccagcccgcgtccgcgccttcttcaatgcgcctgtggtcatcttccacatgaatatc
ctctcctactttgccttcctctgcctgttcgcctacgtgctcatggtggacttccagcct
tctccatcctggtgcgagtacctcatctacctgtggctcttctccctggtgtgcgaagag
actcggcagctattctatgatcctgatggctgtggactaatgaagatggcgtccctgtac
ttcagtgacttctggaacaaactggacgttggggccattctgctcttcatagtaggactg
acctgtcggctcatcccagcgacgctgtaccctgggcgcatcatcctgtctttggacttc
atcatgttctgtctccgtctcatgcacatcttcactattagcaagacactggggcccaag
ataatcatcgtgaagcggatgatgaaggacgtcttcttcttcctctttctcctggcggtg
tgggtggtgtccttcggcgtagctaagcaggccattctcatacataacgagagccgcgtg
gactggatcttccgtggggttgtctatcactcttacctgaccatctttggccagatccca
acctacattgacggtgtgaatttcagcatggaccagtgcagccccaatggcacggacccc
tacaagcctaagtgtcctgagagcgactggacgggacaggcacctgccttccccgagtgg
ctgactgtcaccctgctctgcctctacctgctctttgccaacatcctgctgcttaacctg
ctcatcgccatgttcaactacaccttccaggaggtgcaggaacacacagaccagatctgg
aaattccagcgccacgacctgatcgaggagtaccatggccgtcccccggcacctccccca
ctcatcctcctcagccacctgcagctcctgatcaagaggattgtcctgaagatccctgcc
aagaggcataagcagctcaagaacaagctggagaagaacgaggagacagcgctcctgtct
tgggaactgtacctgaaggagaactacctgcagaaccagcagtaccagcagaaacagcgt
ccagagcagaaaatccaagacatcagtgagaaagtggacaccatggtggatctgctggac
atggaccaggtgaagaggtcaggctccacagagcagagactggcttccctggaggaacag
gtgactcaggtgaccagagctttgcactggatcgtgacaaccctgaaggacagtggcttt
ggctcaggagcaggtgcgctgaccctggcaccccagagggccttcgatgagccagatgct
gagctgagtatcaggaggaaagtagaggaaccaggagatggttaccacgtgagcgcccgg
catctcctctatcccaatgcccgcatcatgcgcttccccgtgcctaacgagaaggtgcct
tgggcggcagagtttctgatctacgatcctcccttttacaccgctgagaaggatgtggct
ctcacagaccccgtgggagacactgcagaacctctgtctaagatcagttacaacgtcgtg
gatggaccgacggaccgtcgcagcttccatggagtctacgtggtcgagtatgggttcccg
ttgaaccccatgggccgcacagggttgcgtggtcgtgggagcctcagctggtttggtccc
aaccacactctgcagccagttgtcacccggtggaagaggaaccagggtggagccatctgc
cggaagagtgtcaggaagatgctggaggtgctagtgatgaagctgcctcgctctgagcac
tgggccttgcctgggggctctagggagccaggggagatgctaccacggaagctgaaacgg
gtcctccggcaggagttctgggtggcctttgagaccttgctgatgcaaggtacagaggta
tacaaagggtacgtggatgacccaaggaacacagacaatgcctggatcgagacagtggct
gtcagcatccattttcaggaccagaatgatatggagctgaagaggctggaagagaacctg
cacactcatgatccaaaggagttgacccgtgacctgaagctgtctactgaatggcaggtg
gtagaccggcggatccctctgtatgcgaaccacaagaccatcctccagaaggtggcctca
ctgtttggagctcacttctga

DBGET integrated database retrieval system