KEGG   Mus musculus (house mouse): 29806
Entry
29806             CDS       T01002                                 
Symbol
Limd1, D9Ertd192e
Name
(RefSeq) LIM domains containing 1
  KO
K16682  LIM domain-containing protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    29806 (Limd1)
   04392 Hippo signaling pathway - multiple species
    29806 (Limd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    29806 (Limd1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    29806 (Limd1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     29806 (Limd1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     29806 (Limd1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 29806
NCBI-ProteinID: NP_038888
MGI: 1352502
Ensembl: ENSMUSG00000025239
UniProt: Q9QXD8
Position
9:123306790..123350617
AA seq 668 aa
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQQQLLQEEALPRAGRSPVNGGNRQGASGKLAADGAAKPPLAVPTVAPGLATTTAAAQPS
YPSQEQRIRPSAHGARPGSQNCGSREGPVSSQRPALHGLSPSCEDPSCLTHGDYYDNFSL
ASPQWGDKPEGCPSVSLGVGSGWPGCPGNDSTLPKSCGDHHPYQPQLSTVCSGRSFESGI
SGQDGGIGGHSSEKPTGLWSTASSQRVNLGFSSMGLENGTSAQPKGTTVSAPMVPSSASQ
GACPKRDSGLGYEASGRVFKPLVDTQPWLQDGPKSYLSVSAPLSSTAGKDSTQPGMTTGL
DPKFGCVESGTSPKPSPTSNVHPVMSTPSELSCKESSPSWSTDSSLEPVLPGSPTPSRVR
LPCQTLAPGPELGPSTAELKLEALTQRLEREMDAHPKADYFGSCVKCSKGVFGAGQACQA
MGDLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMI
LQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPE
GSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKGPSP
APLHQHHF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggataaatacgatgatctgggccttgaggccagtaagttcatcgaggacctgaacatg
tatgaggcctccaaggatgggctcttccgggtggacaagggtgctggcaacaacccagaa
tttgaggaaactcgaagggtgttcgcgaccaagatggccaaaatccacctccagcagcag
caacagcagcagctcctacaggaggaggccctacctagggcaggcagaagcccggtcaac
ggtgggaaccgtcagggtgcgagcggcaagctggctgcagatggggccgctaagcctcct
ctggctgtgccaacagtggcacctggattagctactaccactgcggccgcgcagccctcg
tacccatctcaggagcagaggatcaggccatctgcccatggtgcaaggcctggcagtcag
aactgtggttccagggaggggcctgtgagttcccagagacctgctttacacggcctgagt
ccctcctgtgaagacccttcctgcctcactcacggagactattatgacaatttctctttg
gcaagcccacagtggggtgataaacctgaagggtgccccagcgtgagtctgggtgtagga
agtggatggcctggttgcccagggaatgactccacattgcccaaatcctgtggagaccat
cacccttaccagccacagctctccacagtgtgctctggcaggtcttttgaaagtggcatc
agtggccaggacggtggcattggtggccatagcagcgagaagccaacaggcctttggtcc
actgcctcctctcagcgagtgaacctcggtttttcttccatgggcttggagaatgggacc
tccgctcaacccaagggcacaactgtttcagcaccgatggtccctagcagcgccagccaa
ggagcttgtccgaaaagagattcaggtctgggatatgaggcttcaggcagggtcttcaaa
ccccttgtggacactcagccttggctgcaggatgggcccaagtcttacctctcagtttct
gctccattatcctcgacagctggcaaggacagtacccagccaggtatgaccaccgggctg
gatcctaagtttggatgcgtggagtctggcactagtcccaagcccagccccaccagtaac
gtccatccggtaatgtccactccatctgagttatcttgtaaagagagttctcccagctgg
tccactgacagtagtctggaacctgtgctcccagggagtcccaccccctccagggtgaga
ttgccctgccagaccctcgcaccgggccctgagcttggaccctccactgcggaattgaag
ttggaagccctcacccagcgtctggagcgagagatggatgctcaccccaaagcggactac
ttcggttcctgtgtgaaatgcagcaaaggggtgtttggagctggccaggcctgtcaggcc
atgggagatctctaccacgatgcgtgcttcacctgtgcagcctgcagcaggaagttaaga
ggaaaggccttctattttgtcaatggcaaagtattctgtgaggaagactttttgtattct
ggctttcagcagtctgcggacaggtgttttctttgtggacacctgatcatggacatgatc
ctacaggccctagggaagtcctatcaccccggctgtttccgctgcgtcatctgtaatgaa
tgtctggatggggttcctttcaccgtggactctgagaacaagatctactgtgtccgagac
tatcacaaggtgctggcccccaagtgtgcagcctgtggccttcccatccttccgccagag
ggttcagacgagaccatcagagttgtgtccatggacagggactaccacgtagagtgctac
cactgtgaggactgtggtctggagctcaatgacgaggacggtcaccgctgctatccactg
gaggaccacctgttctgtcactcctgccatgtcaagagactggagaaaggaccctcacct
gcacccctccaccagcaccacttctag

DBGET integrated database retrieval system