KEGG   Mus musculus (house mouse): 29807
Entry
29807             CDS       T01002                                 
Symbol
Tpk1
Name
(RefSeq) thiamine pyrophosphokinase
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00730  Thiamine metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    29807 (Tpk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     29807 (Tpk1)
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding
Other DBs
NCBI-GeneID: 29807
NCBI-ProteinID: NP_038889
MGI: 1352500
Ensembl: ENSMUSG00000029735
Vega: OTTMUSG00000023547
UniProt: Q9R0M5
Structure
Position
6:complement(43316510..43644726)
AA seq 243 aa
MEHAFTPLEPLLPTGNLKYCLVVLNQPLDARFRHLWKKALLRACADGGANHLYDLTEGER
ESFLPEFVSGDFDSIRPEVKEYYTKKGCDLISTPDQDHTDFTKCLQVLQRKIEEKELQVD
VIVTLGGLGGRFDQIMASVNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEG
SWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLVTVETDHPLLWTMA
IKS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggagcatgcctttaccccgttggaacccctgctacctacggggaacttgaaatactgc
cttgtggttcttaatcagcctttggatgcacgatttcgccatctttggaaaaaagctctc
ttaagagcctgtgctgatgggggtgccaaccacttatatgatctcactgaaggagagaga
gaaagcttcttgcctgaattcgtcagtggggactttgattctattaggcctgaagtcaaa
gagtactacaccaagaagggctgtgatcttatttcaactcctgaccaagaccacactgac
tttaccaagtgtcttcaagtgctccaaaggaagatagaggaaaaggaactgcaggttgac
gtgattgtgacactgggaggtctcggtgggcgttttgaccaaatcatggcctctgtgaat
acccttttccaagccactcacatcactcctgtgccgattataataatccaaaaggactct
ctcatctacctcctccaacccgggaagcacaggctccatgtagacactggaatggaaggg
agctggtgtggcctgattcctgttggacagccttgcaaccaggtgacgacaacaggcctg
aaatggaacctcacaaatgatgttcttggctttggaacactggtcagtacttctaacacc
tacgatgggtccggccttgtcactgtggaaactgaccacccactcctctggaccatggcc
atcaagagctaa

DBGET integrated database retrieval system