KEGG   Mus musculus (mouse): 29809
Entry
29809             CDS       T01002                                 

Gene name
Rabgap1l, 5830411O09Rik, 8430421H08Rik, 9630005B12Rik, AW049894, HHL, Hh1, mKIAA0471
Definition
(RefSeq) RAB GTPase activating protein 1-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RabGAP-TBC DUF3694 PID PTB
Other DBs
NCBI-GeneID: 29809
NCBI-ProteinID: NP_038890
MGI: 1352507
Ensembl: ENSMUSG00000026721
Vega: OTTMUSG00000050683
UniProt: A6H6A9
Position
1; 1 H2.1
AA seq 815 aa
MEVRASFQKVSGSSDSVATLNSEEFVLVSQHTDATSIKDDGKPQLKIASNGDEQLEKAME
EILRDSEKGQSGLPVDCQGSSEISDCPFGDVPASQTTKPPLQLILDPSNTEISTPRPSSP
SRFPEEDSVLFNKLTYLGCMKVSSPRSEVEALRAMATMRASSQYPFAVTLYVPNVPEGSV
RIIDQSSNVEIASFPIYKVLFCARGHDGTAESNCFAFTESSHGSEEFQIHVFSCEIKEAV
SRILYSFCTAFKRSSRQVSDVKDSVIPTPDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDK
FYFKIKQGIEKKVVITVQQLSNKELAIERCFGMLLSPGRNVKNSDMHLLDMESMGKSYDG
RAYVITGMWNPNAPIFLALNEETPKDKRVYMTVAVDMVVTEVVEPVRFLLETVVRVYPAN
ERFWYFSRKTFTETFFMRLKQSEGKGHSSAGDAIYEVVSLQRESDKEEPITPTSAGGPMS
PQEDEAEEESDNELSSGTGDVSKDCPEKILYSWGELLGRWHNNLGGRPKGLFTLVKSGVP
EALRAEVWQLLAGCHDNQEMLDKYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQ
ESLYKICKAYSVFDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVTIMYGYKLRDLYRNNF
EDLHCKFYQLEKLMQEQLPDLYSHFCDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLL
LCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK
VPTKKLKKYEKEYQAMRENQLQQEDPMDRYKFVYL
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggaggtcagagcttcgttccagaaggttagtgggtcatctgattctgtggccacactg
aacagtgaagaatttgttttggtttctcagcacacagatgccacttctataaaggatgat
gggaagccacagctgaagatagcttccaatggtgatgagcagttggaaaaagccatggaa
gagattttgagagattccgagaaaggacaaagcggtctacctgttgattgccaaggatcc
agtgagatttcagactgtccctttggagatgtgccggccagccaaacaactaagccgcct
ctccagttaattttggatccatctaatacagaaatttccacacccagaccatcttctcca
agcagatttcctgaagaagacagtgttctctttaacaagctgacatacttaggatgtatg
aaggtttcttccccacgcagtgaagtggaggctttacgggccatggccaccatgagagct
tccagtcagtacccctttgctgttactctgtatgtgcccaatgttccagaaggatctgtg
agaatcatagaccagtcaagcaatgtggagatagcatcttttccaatttataaagtgctt
ttctgtgcacgtgggcatgatgggacagccgagagcaattgctttgcatttacagagagt
tctcatggctcagaagaatttcagatacatgttttctcctgtgaaattaaagaggcagta
agcagaattttatatagtttctgcactgcattcaaacgttcttccagacaagtgtctgat
gttaaagactcagtcatcccgactcccgacagtgatgtgtttaccttcagtgtttccttg
gaggtcaaagaagatgatggaaaaggaaactttagtcccgtgcctaaggatagagataaa
ttttatttcaaaataaagcaaggaatagagaagaaggttgtgattacagttcagcaactg
tctaacaaagaattagctattgagagatgttttggaatgttattaagcccaggtcgaaac
gtgaagaacagtgacatgcatttactggatatggagtccatgggaaagagctatgatggg
agagcttacgtcatcacgggcatgtggaaccccaacgcaccaatatttctggctcttaat
gaagaaacgcccaaagataaacgggtgtacatgaccgttgcagtggacatggtggtcaca
gaggtggtggagccagtccgttttctcctggagacagtagttcgtgtataccctgcaaat
gagagattttggtatttcagcagaaagactttcacagagactttcttcatgaggttgaaa
cagtctgagggaaaaggccacagcagtgctggagatgcaatatatgaagtggtgagtctg
cagagagaatctgacaaggaggagcccatcacccctactagtgctgggggcccaatgtca
ccacaggaggatgaagcagaagaggagagtgataatgaactctcgagtggaacaggtgat
gtgtcaaaagactgtcctgagaagattctctattcttggggagaattgttaggaagatgg
cacaataaccttggtggccgaccaaaaggactattcaccttggtaaagagtggtgttcct
gaggcactaagggcagaagtatggcaactattagcaggatgccatgacaatcaggaaatg
ctggataaataccgaatccttatcacaaaggactctgcacaggagagtgttattactcga
gatattcatcgtacatttcctgcacacgattacttcaaagacactggaggcgatggtcaa
gaatccctttacaaaatctgcaaggcctactcggtgttcgatgaagacattgggtactgt
caaggacagtcttttcttgctgctgtactactgttgcatatgccagaggagcaagcattc
tgtgttttggtgactattatgtatggttataaattgagagacttatacagaaacaatttt
gaagatcttcattgcaaattctatcaacttgagaaactaatgcaggaacagctgccagac
ctgtacagccacttctgtgatctgaacctggaagctcatatgtatgcatcccagtggttc
ctcactctctttactgccaagtttccactctgcatggtgttccacatcattgaccttctg
ctgtgtgagggtttgaatataatctttcatgtagctttggctcttctaaagacctcaaag
gaagacctccttcaggctgattttgaaggtgctttgaagtttttcagagttcagcttcca
aagagataccgggcagaggagaatgcaagaagattgatggaacaggcttgcaatattaaa
gtaccaaccaaaaagctgaagaaatatgaaaaagaatatcaggcgatgcgggagaatcag
ctgcagcaggaggacccaatggatagatacaagtttgtatatttatag

DBGET integrated database retrieval system