KEGG   Mus musculus (mouse): 29815
Entry
29815             CDS       T01002                                 

Gene name
Bcar3, AI131758, AND-34
Definition
(RefSeq) breast cancer anti-estrogen resistance 3
  KO
K23688   
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SH2 RasGEF
Other DBs
NCBI-GeneID: 29815
NCBI-ProteinID: NP_038895
MGI: 1352501
Ensembl: ENSMUSG00000028121
Vega: OTTMUSG00000052422
UniProt: Q9QZK2
Position
3; 3 G1
AA seq 820 aa
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAERRTDAYQDVSIHGTLPRKKKGPPS
IRSCDNAGHSKSPRQSSPLTQDIIQENPLQDRKGENFIFRDPYLLDPTLEYVKFSKERHI
MDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNF
VLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRPISQQSG
AIIFQPINRTVPLWCLEERYGTSPGRGREGSLAEGRPDVVKRLSLTTGSSIQAREHSLPR
GNLLRNKEKSGSQPACLDHVQDRKALTLKAHQSESHLPIGCKLPPQSPSMDTSPCPSSPV
FRTGSEPTLSPALVRRFSSDARTGEALRGSDSQLCPKPPPKPCKVPFLKTPPSPSPWLTS
EANYCELNPAFAVGCDRGAKLPMQAHDSHEMLLTAKQNGPSGPRNSGINYMILDGDDQAR
HWDPLAVQTDEGQEDKTKFVPPLMETVSSFRPNDFESKLLPPENKPLETAMLKHAKELFT
NHDARVIAQHMLSVDCKVARILEVSEDRKRSMGVSSGLELITLPHGRQLRLDIIERHNTM
AIGIAVDILGCTGTLENRAGTLNKIIQVAVELKDAMGDLYAFSAIMKALEMPQITRLEKT
WTALRHHYTQTAILYEKQLKPFSKILHEGRESTYVPASNVSVPLLMPLVTLMERQAVTFE
GTDMWENNDESCEILLNHLATARFMAEASESYRMNAERILADFQPDEEMTEILRTEFQMR
LLWGSKGAEVNQNERYDKFNQILTALSRKLEPPSGKQAEL
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggctgcgggaaagtttgcaagccttcccagaaacatgcctgtgaatcaccagttcccc
ttggcctcgtccatggacctcctgagcagcaagtcccctcttgctgagcgtcgcacagat
gcctatcaagacgtgtctatacatggcactcttccacggaagaaaaagggccctccttcc
atacggtcctgtgacaatgctggccactccaaatccccacgacagagctcacctctgacc
caggacatcatccaggaaaacccactgcaagaccggaaaggggaaaacttcatcttcagg
gatccatatcttctggacccaactctggaatacgtgaagttctccaaggagaggcacatc
atggacaggacccctgagaggctgaaaaaggaattggaggaggagctgctgctgagcagc
gaagacctacgcagccacgcctggtaccacggccggatcccccgacaggtgtctgaaaac
cttgtgcagcgggatggggacttcctggttcgcgactccctgtcgagccccggaaacttt
gtcctgacctgtcagtggaagaacctcgctcagcactttaagatcaaccggactgtcctg
cggctcagcgaggcctacagccgtgtgcagtaccaattcgagatggagagctttgactcc
atcccggggctggtccgctgctacgtgggcaaccggcggcccatctcccaacagagtggt
gccatcatcttccagcccatcaataggacagtgcccctctggtgtctggaggagcgttat
ggcacctccccgggccgaggccgggagggcagcctggctgagggaaggccagacgtggtg
aagaggctgagcctcaccacaggcagcagcatccaggctcgggaacacagcctgccccga
ggaaacctcctcaggaataaagagaagagtggcagccagcccgcctgcctggatcacgtg
caggacaggaaggccttaaccctcaaagctcaccagtcggagagtcacctgccaataggc
tgcaagctgcccccccagtctccgagtatggacacaagcccttgccccagctctcccgtg
ttcaggactggcagcgagcccactctgagtccagcactggtacgaaggttctcttcagat
gctaggacaggggaggcgcttcggggatcagacagccagctgtgccccaagccacccccg
aagccctgcaaggtgcccttcctcaagactcccccctctccatctccctggctcacctca
gaggccaactactgtgaactgaaccctgcttttgctgtgggctgtgacaggggagccaag
cttcccatgcaagcccacgacagccacgagatgctgctgacagccaaacagaatgggcca
tcgggtccccggaactctggcatcaactacatgatccttgatggggatgaccaggcgaga
cattgggatccactggcagtgcagacggatgaaggtcaggaggacaagaccaagtttgtg
ccacctctcatggagaccgtgtcgtcattcagacccaatgactttgagtccaagcttctt
cctccagagaacaaacccctggaaacggccatgctgaagcacgcgaaagaactgttcacc
aaccacgatgccagggtcattgcgcagcacatgctgagcgtggactgcaaggttgctagg
atactcgaagtctctgaagacaggaagaggagcatgggtgtgagctctgggttggagctc
attactttacctcatggacggcagctgcgcctggacatcatcgagaggcacaacaccatg
gccattggcattgctgtggacattctgggctgcacaggcacactggagaaccgagcgggt
accctcaataagatcatccaggtggcggtggaactgaaggatgccatgggagacctctat
gctttctctgccatcatgaaagccctggagatgcctcagatcacaaggttagagaaaaca
tggacggctctgaggcaccactacacgcagacagccatcctctatgagaagcagttgaag
ccctttagcaaaatcctgcatgaaggcagagagtctacatatgtcccagcaagcaatgtg
tcagtccctctgctgatgccactggtgaccttaatggaacgccaggctgtcacttttgaa
gggaccgacatgtgggaaaacaatgacgagagctgtgaaattctgctgaatcacttggca
acagccaggttcatggctgaggcttctgagagctacaggatgaatgctgagaggatcctg
gcagatttccaaccagatgaagaaatgactgagatcttaaggactgagttccagatgaga
ttgttatggggcagcaagggcgccgaagtcaaccagaacgagagatacgacaagttcaac
cagatcctaacagccctctcacggaaactagaacctccctctggaaagcaggccgagctg
tga

DBGET integrated database retrieval system