KEGG   Mus musculus (mouse): 29816
Entry
29816             CDS       T01002                                 

Gene name
Hip1r, AA410023, mKIAA0655
Definition
(RefSeq) huntingtin interacting protein 1 related
  KO
K20040  huntingtin-interacting protein 1-related protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    29816 (Hip1r)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    29816 (Hip1r)
Motif
Pfam: ANTH I_LWEQ HIP1_clath_bdg
Other DBs
NCBI-GeneID: 29816
NCBI-ProteinID: NP_659507
MGI: 1352504
Ensembl: ENSMUSG00000000915
Vega: OTTMUSG00000035912
UniProt: Q9JKY5
Position
5; 5 F
AA seq 1068 aa
MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINSQEAPVKEKHARRIILGTHH
EKGAFTFWSYAIGLPLSSSSILSWKFCHVLHKVLRDGHPNVLHDYQRYRSNIREIGDLWG
HLRDQYGHLVNIYTKLLLTKISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMF
DYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLMFKLHSC
LPADTLQGHRDRFHEQFHSLKNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIK
PVVVIPEEAPEEEEPENLIEISSAPPAGEPVVVADLFDQTFGPPNGSMKDDRDLQIENLK
REVETLRAELEKIKMEAQRYISQLKGQVNGLEAELEEQRKQKQKALVDNEQLRHELAQLK
ALQLEGARNQGLREEAERKASATEARYSKLKEKHSELINTHAELLRKNADTAKQLTVTQQ
SQEEVARVKEQLAFQMEQAKRESEMKMEEQSDQLEKLKRELAARAGELARAQEALSRTEQ
SGSELSSRLDTLNAEKEALSGVVRQREAELLAAQSLVREKEEALSQEQQRSSQEKGELRG
QLAEKESQEQGLRQKLLDEQLAVLRSAAAEAEAILQDAVSKLDDPLHLRCTSSPDYLVSR
AQAALDSVSGLEQGHTQYLASSEDASALVAALTRFSHLAADTIVNGAATSHLAPTDPADR
LMDTCRECGARALELVGQLQDQTVLPRAQPSLMRAPLQGILQLGQDLKPKSLDVRQEELG
AMVDKEMAATSAAIEDAVRRIEDMMSQARHESSGVKLEVNERILNSCTDLMKAIRLLVMT
STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVESADKVVLHMGKY
EELIVCSHEIAASTAQLVAASKVKANKNSPHLSRLQECSRTVNERAANVVASTKSGQEQI
EDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERVRLGELRKQHYVLAGGMGTPSE
EEPSRPSPAPRSGATKKPPLAQKPSIAPRTDNQLDKKDGVYPAQLVNY
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgaacagcatcaagaatgtgccggcgcgggtgctgagccgcaggccgggccacagccta
gaggccgagcgcgagcagttcgacaagacgcaggccatcagtatcagcaaagccatcaac
agccaggaggccccagtgaaggagaagcatgcccggcgtatcatcctgggcacgcatcat
gagaagggagcctttaccttctggtcctatgccatcggcctgccgctgtccagcagctcc
atcctcagctggaagttctgtcacgtccttcacaaggtcctccgggacggacaccccaac
gtcctgcatgactatcagcggtaccggagcaacatacgtgagatcggtgacttgtggggc
caccttcgtgaccagtatggacacctggtgaatatctataccaaactgttgctgactaag
atctccttccaccttaagcatccccagtttcctgcaggcctggaggtaacagatgaggtg
ttggagaaggcggcgggaactgatgtcaacaacatttttcagcttaccgtggagatgttt
gactacatggactgtgaactgaagctttctgagtcagttttccggcagctcaacacggcc
atcgcagtgtcccagatgtcttctggccagtgtcgcctagcgccgctcatccaggtcatt
caggactgcagccacctgtaccactacacagtgaagctcatgtttaagctgcactcctgt
ctcccggcagacaccctgcaaggccacagggatcggttccacgagcagtttcacagcctc
aaaaacttcttccgccgagcttcagacatgctgtacttcaagaggctcatccagatcccg
cggctgcctgagggaccccccaatttcctgcgggcttcagccctggctgagcacatcaag
ccggtggtggtgattcccgaggaggccccagaggaagaggagcctgagaacctaattgaa
atcagcagtgcaccccctgctggggagccagtggtggtggctgacctctttgatcagacc
tttggaccccccaatggctccatgaaggatgacagggacctccaaatcgagaacttgaag
agagaggtggagaccctccgtgctgagctggagaagattaagatggaggcacagcggtac
atctcccagctgaagggccaggtgaatggcctggaggcagagctggaggagcagcgcaag
cagaagcagaaggccctggtggacaacgagcagctgcgccacgagctggcccagctcaag
gccctgcagctggagggcgcccgcaaccagggccttcgagaggaagcagagaggaaggcc
agtgccacggaggcacgctacagcaagctgaaggagaaacacagcgaactcattaacacc
cacgccgagctgctcaggaagaacgcagacacggccaagcagctgacagtgacacagcag
agccaggaggaggtggcacgggtaaaggaacagctggccttccagatggagcaagcgaag
cgtgagtctgagatgaagatggaagagcagagcgaccagttggagaagctcaagagggag
ctggcggccagggcaggagagctggcccgtgcgcaggaggccctgagccgcacagaacag
agtgggtcagagctgagctcacggctggacacactgaatgcggagaaggaagctctgagt
ggagtcgttcggcagcgtgaggcagagctgctggccgctcagagcctggtgcgggagaag
gaggaggcacttagccaagagcagcagcggagctcccaggagaagggcgagctacggggg
cagctggcagaaaaggagtctcaggagcaggggcttcggcagaagctgctggatgagcag
ttggcggtgttgcgaagtgcagccgccgaggcagaggccatcctacaggatgcagtgagc
aagctggacgaccccctgcacctccgctgcaccagctccccagactacttggtgagccgg
gctcaggcagccctggacagcgtgagcggcctggagcagggccacacccagtacctggct
tcctctgaagatgcttctgccctggtggcagcgctgacccgcttctcccatttggctgcg
gacaccattgtcaatggtgccgccacctcccacctggcccccaccgaccccgccgaccgc
ctgatggacacatgcagggagtgtggagcccgggctctggagctggtgggacagctgcaa
gaccagacagtgctaccgagggctcagcccagcctgatgcgggcccccctgcagggcatt
ctgcagttgggccaggacttgaagcctaagagcctggatgtacggcaagaggagctaggg
gccatggtggacaaggagatggcggccacctcggcagccattgaggacgctgtgcggagg
atcgaggacatgatgagccaggcccgccacgagagctcgggcgtgaaactggaggtgaat
gagaggatcctcaactcctgcacagacctgatgaaggctatccggctcctggtgatgacc
tccaccagcctgcagaaggaaattgtggagagcggcaggggggcagcaacgcagcaggaa
ttttatgccaagaattcacggtggactgaaggcctcatctcagcctctaaggcagtgggc
tggggagccacacagctggtggagtcagctgacaaggttgtgcttcacatgggcaaatac
gaggaactcatcgtctgctcccatgagattgcggccagcacggcccagctggtggcagcc
tcgaaggtgaaagccaacaagaacagtccccacttgagccgcctgcaggaatgttcccgc
actgtcaacgagagggctgccaacgtcgtggcctccaccaaatctggccaggagcagatt
gaggacagagacaccatggatttctctggcctgtccctcatcaagttgaagaagcaggag
atggagacacaggtgcgagtcttggagctggagaagacactagaggcagagcgtgtccgg
ctcggggagcttcggaaacagcactatgtactggctggggggatgggaacacctagcgaa
gaagaacccagcagacccagcccagctccccgaagtggggccactaagaagccaccgctg
gcccagaaacccagcatagcccccaggacagacaaccagctcgacaaaaaggatggtgtc
tacccagctcaacttgtgaactactag

DBGET integrated database retrieval system