KEGG   Mus musculus (mouse): 29817
Entry
29817             CDS       T01002                                 

Gene name
Igfbp7, AG, AGM, Fst, Fstl2, Mac25, mac2
Definition
(RefSeq) insulin-like growth factor binding protein 7
  KO
K23580  insulin-like growth factor-binding protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    29817 (Igfbp7)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    29817 (Igfbp7)
SSDB
Motif
Pfam: I-set Ig_3 Kazal_2 IGFBP ig Kazal_1 Ig_2 V-set
Other DBs
NCBI-GeneID: 29817
NCBI-ProteinID: NP_032074
MGI: 1352480
Ensembl: ENSMUSG00000036256
Vega: OTTMUSG00000056133
UniProt: Q61581 F8WH23
Position
5; 5 C3.3
AA seq 282 aa
MMERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCC
PVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVC
GSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLS
CEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSK
EDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
NT seq 849 nt   +upstreamnt  +downstreamnt
atgatggagcggccgccgcgcgccctgctgctgggtgcagccggactgctgctcctgctc
ctgcccctctcctcttcctcctcttcggatgcctgcggcccgtgcgtgccggcctcctgc
cccgcgctgccccggctcggctgcccgctgggtgagacccgcgacgcgtgcgggtgctgc
ccggtgtgtgctcgcggcgagggtgagccgtgcgggggcggcgcggccggcagggggcac
tgcgcgccgggcatggagtgcgtgaagagccgcaagaggcggaagggtaaagccggggca
gcagccggcggtcccgcgaccctcgccgtgtgcgtgtgcaagagccgctacccggtgtgc
ggcagcaacggcatcacctaccccagcggctgccagctgcgcgctgccagcctgcgcgcc
gagagccgcggggagaaggccatcacccaggtcagcaagggcacctgcgagcaaggtcct
tccatagtgacgccccccaaggacatctggaacgtcactggtgccaaggtgttcttgagc
tgtgaggtcatcgggatcccaacccctgtcctcatctggaacaaggtaaaaagggatcac
tctggagttcagcggacagaactcttgcctggtgaccgggaaaatctggccattcagacc
cggggtggtccagaaaagcatgaagtaacgggctgggtgctggtatctcctctaagtaag
gaggacgctggagagtatgagtgccacgcatccaactcccaagggcaggcttccgcggca
gccaaaattacagtggttgatgccctccatgaaataccactgaaaaaaggtgaaggtgct
cagttataa

DBGET integrated database retrieval system