KEGG   Mus musculus (mouse): 29818Help
Entry
29818             CDS       T01002                                 

Gene name
Hspb7, 27kDa, Hsp25-2, cvHsp
Definition
(RefSeq) heat shock protein family, member 7 (cardiovascular)
  KO
K09546  heat shock protein beta-7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    29818 (Hspb7)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   29818 (Hspb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20
Motif
Other DBs
NCBI-GeneID: 29818
NCBI-ProteinID: NP_038896
MGI: 1352494
Ensembl: ENSMUSG00000006221
Vega: OTTMUSG00000010297
UniProt: P35385
Position
4; 4 D3
AA seq 169 aa AA seqDB search
MSHRTSSAFRAERSFRSSSSSSSSSSSSASRALPAQDPPMEKALSMFSDDFGSFMLPHSE
PLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTFNNHIEVRAEKLAADGTVMNT
FAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcggacctcctccgccttcagagcggagagaagcttccgttcctcttcctcc
tcctcctcctcctcttcttcttcggcctcccgtgcccttccagcccaggacccacccatg
gagaaggctttgagcatgttttcagacgactttggcagttttatgctgccccactcggag
cccctggccttcccagcccgtcccgggggccaaggaaacatcaagaccctcggggatgcc
tacgagtttacagtggacatgagagacttctcccctgaagacatcattgtcaccaccttc
aacaaccacatcgaggtgcgggctgagaagctggcagctgatggcacagtcatgaacacc
tttgctcacaagtgccaactaccagaggatgtggacccaacatcggtgacctcggccctt
cgagaggatggtagcctcaccatccgggcgcggcgccacccccacacagaacatgtccag
cagaccttccggactgagataaaaatctga

DBGET integrated database retrieval system