KEGG   Mus musculus (mouse): 29819
Entry
29819             CDS       T01002                                 

Gene name
Stau2
Definition
(RefSeq) staufen double-stranded RNA binding protein 2
  KO
K17597  double-stranded RNA-binding protein Staufen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    29819 (Stau2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    29819 (Stau2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29819 (Stau2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     29819 (Stau2)
   mRNA cycle factors
    Stress granule specific factors
     29819 (Stau2)
SSDB
Motif
Pfam: dsrm Staufen_C DND1_DSRM
Other DBs
NCBI-GeneID: 29819
NCBI-ProteinID: NP_079579
MGI: 1352508
Ensembl: ENSMUSG00000025920
Vega: OTTMUSG00000033135
UniProt: Q8CJ67
Structure
PDB: 
1UHZ

Position
1; 1 A3
AA seq 570 aa
MANPKEKTPVCLVNELARFHSIQPQYKLLNESGPAHSKMFSVQLSLGEQTWESEGSSIKK
AQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKP
FPNYRANYNFRGMYNQRYHCPMPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQ
NEPIPEKSPQNGESGKEMDDDKDANKSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFV
TRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRPKTIVKAGP
DYGQGMNPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTGPNKKI
AKKNAAEAMLLQLGYKASTSLQDPLDKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY
QEMEASRHRVTSGTTLSYLSPKDMNQPSSSFFSVSPSSTSSATVARELLMNGTSPTAEAI
GLKGSSPTSPCSSVQPSKQLEYLARIQGFQAALSALKQFSEQGLESIDGAVNVEKGSLEK
QAKHLREKADNNQAKPASISQDCKKSKSAI
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcaaaccccaaagagaaaactccagtgtgtctggtaaatgagttagcccgtttccat
agcatccaaccccagtataagcttctgaatgaaagcgggcctgctcattcgaagatgttt
tcggtgcagctgagtcttggcgagcagacatgggaatccgaagggagcagtataaagaag
gcccaacaagctgttgctaacaaagctttgactgaatctacgcttcccaaaccagttcag
aaaccacctaaaagtaatgtcaataataacccaggtagtataactccaactgtggaactg
aatgggctcgctatgaaaaggggagagcctgccatctacaggccactagatccaaagcca
ttcccaaattatagagctaactacaacttccggggcatgtacaatcagaggtatcattgc
ccaatgcccaagatcttttatgttcagttaactgtaggaaataatgaattctttggtgaa
gggaagactcgacaagctgccagacacaatgctgcgatgaaagcgcttcaagccctacag
aatgagccaattccagaaaagtctccccagaatggtgaatcaggaaaagaaatggatgac
gataaagatgcaaataaatctgaaataagcttagtgtttgagattgcgctgaagagaaat
atgcctgtcagttttgaggttattaaagaaagtggaccaccacatatgaagagttttgta
actcgggtgtcagtgggagaattttctgcagaaggagagggaaatagcaaaaaactctcc
aagaagcgtgccgcaaccactgtcttacaggagcttaaaaaactcccacctcttcctgtg
gtagagaagccaaaactattttttaaaaaacgccctaaaacaatagtaaaggctggaccc
gactatggtcaaggaatgaaccccattagccgcctggctcagatccagcaagccagaaag
gaaaaggagcctgattacatcctactctcagaacgaggaatgcctcgccgtcgagagttc
gtaatgcaggtcaaggtaggcaatgaagttgcgactggaacaggacccaataaaaagata
gccaaaaaaaatgctgctgaagcaatgctgttacagcttggctataaagcgtccaccagt
cttcaggatccgctcgacaagacaggtgaaaacaaaggatggagtggtccaaagcctggg
tttcctgaaccaacaaataacactccaaaaggaattcttcatctttctcctgatgtttat
caagagatggaagctagccgccacagagtgacctctggcacaactctaagctacttatct
cccaaagatatgaaccaaccttcaagctctttcttcagtgtgtctccctcatcaactagt
tcagccacagttgccagggaactccttatgaatggaacatctcctactgctgaagccata
ggtttaaaaggaagttctcctacttccccttgttcttcagtacagccttcaaaacaactg
gaatatttagcaaggattcaaggctttcaggcagccttaagtgccttgaaacagttttct
gaacaaggactggaatcaattgatggggcagtgaatgttgaaaagggttctcttgaaaaa
caagccaagcatctgcgggagaaagcagacaataaccaggcgaagccggcctccatctct
caggactgcaagaaatcaaagtcggccatctag

DBGET integrated database retrieval system