KEGG   Mus musculus (house mouse): 29861
Entry
29861             CDS       T01002                                 
Symbol
Dpf1, Neud4
Name
(RefSeq) double PHD fingers 1
  KO
K22198  BRG1-associated factor 45B/C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04714  Thermogenesis
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    29861 (Dpf1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    29861 (Dpf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    29861 (Dpf1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    29861 (Dpf1)
SSDB
Motif
Pfam: DPF1-3_N PHD zf-C2H2 zf-C2H2_4 zf-H2C2_2 Prok-RING_1
Other DBs
NCBI-GeneID: 29861
NCBI-ProteinID: NP_038902
MGI: 1352748
Ensembl: ENSMUSG00000030584
UniProt: Q9QX66 Q6GTK4
Position
7:29003366..29017017
AA seq 388 aa
MATAIQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKT
HRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEA
LLCAETGEKKVELKEEETIMDCQKQQLLEFPHDLEVEDLEEDIPRRKNRARGKAYGIGGL
RKRQDTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEEHTERHALPFHRKN
NHKQFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRS
GHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPM
AEPPEGSWSCHLCLRHLKEKASAYITLT
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggccaccgccattcagaacccgctcaagtcccttggcgaggacttctaccgggaggcc
atcgagcactgtcgcagctacaacgcgcgcctgtgtgccgagcgcagcctgcgcctgcct
ttcctcgactcgcagaccggagtggcccagaacaactgctacatctggatggagaagacc
caccgcgggcctggtttggccccgggacagatctacacttaccccgcccgctgttggagg
aagaaacggagactcaacatcctggaggaccccaggctccggccctgcgagtacaagatc
gattgtgaggcacctctgaagaaggagggtggcctcccggaagggccagtcctcgaggct
ctgctgtgtgctgagactggagagaagaaagtggagctgaaggaggaggagaccatcatg
gactgtcagaaacagcagttgctggagtttccgcatgatctcgaggtagaagacttggag
gaagacattcccaggaggaagaacagggcaagaggaaaggcatatggcattggaggtctc
cgcaaacgccaggacaccgcatccctggaggaccgagacaagccgtacgtctgtgatatc
tgtgggaagagatataagaaccggccaggactcagctaccattacacccacacccacctg
gctgaggaggagggggaggagcacactgaacgccacgccctgcctttccaccggaaaaac
aaccataaacagttttacaaagaattggcctgggtccccgaggcacagaggaaacacaca
gccaagaaagcaccagatggcactgtcatccccaatggctactgtgacttttgcctgggg
ggctccaagaagactgggtgtcccgaggacctcatctcctgtgcggactgtgggcgatca
ggacatccctcgtgtttacagttcacggtgaacatgaccgcggctgtgcggacctaccgc
tggcagtgcattgaatgcaagtcctgcagcctgtgtggcacctcggagaatgacgaccag
ctgctgttctgtgatgactgcgatcgaggttaccacatgtactgcctgagccctcccatg
gcggagcccccggaagggagctggagctgccacctctgtctccggcacttgaaggaaaag
gcctctgcttacatcaccctgacctag

DBGET integrated database retrieval system