KEGG   Mus musculus (mouse): 29867
Entry
29867             CDS       T01002                                 

Gene name
Cabp1, cald, caldendrin
Definition
(RefSeq) calcium binding protein 1
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    29867 (Cabp1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    29867 (Cabp1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    29867 (Cabp1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   29867 (Cabp1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 SPARC_Ca_bdg Dockerin_1 DIMCO_N TerB EF-hand_4 POTRA_2
Other DBs
NCBI-GeneID: 29867
NCBI-ProteinID: NP_038907
MGI: 1352750
Ensembl: ENSMUSG00000029544
Vega: OTTMUSG00000014631
UniProt: Q9JLK7
Position
5; 5 F
AA seq 227 aa
MGNCVKSPLRNLSRKMRQEEKTSYMAVQTSEDGLADGGELHGPLMMLAQNCAVMHNLLGP
ACIFLRKGFAENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTE
MELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEIS
TSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggcaactgcgtcaagtcgccactaagaaacctctcaagaaagatgcgccaggaggag
aagaccagctacatggcggtgcagacaagcgaggacgggctggcggatggcggcgagctc
catggaccactcatgatgctggcccagaactgtgcggtcatgcacaacctgctgggtccc
gcctgcatttttctccgaaagggttttgctgagaacagacaacctgacagatcgttacga
ccagaggagattgaagagctccgagaggccttccgagaatttgacaaagacaaggatggt
tacatcaactgccgggacctggggaactgcatgcgcaccatgggctacatgcccaccgag
atggagctcattgagctgtctcagcagatcaacatgaacctgggtggccacgtggatttt
gatgactttgtggaactgatgggccctaaactcctggcggagacggcagatatgattggt
gtaaaggagctgagagacgcctttcgggagtttgataccaacggtgacggggagataagt
acgagcgagcttcgagaggccatgaggaagctcctgggtcatcaggtgggacaccgggac
atagaggaaattatccgagacgtggacctcaatggagatggacgagtggactttgaagag
tttgtccggatgatgtctcgctga

DBGET integrated database retrieval system