KEGG   Mus musculus (mouse): 29876
Entry
29876             CDS       T01002                                 

Gene name
Clic4, D0Jmb3, TU-74, mc3s, mc3s5, mtCL, mtCLIC
Definition
(RefSeq) chloride intracellular channel 4 (mitochondrial)
  KO
K05024  chloride intracellular channel protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    29876 (Clic4)
   04040 Ion channels [BR:mmu04040]
    29876 (Clic4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29876 (Clic4)
  Exosomal proteins of colorectal cancer cells
   29876 (Clic4)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   29876 (Clic4)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C
Other DBs
NCBI-GeneID: 29876
NCBI-ProteinID: NP_038913
MGI: 1352754
Ensembl: ENSMUSG00000037242
Vega: OTTMUSG00000009685
UniProt: Q9QYB1 Q543N5
Position
4; 4 D3
AA seq 253 aa
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLD
GDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgctgtcgatgcccctgaacgggctgaaggaggaggacaaagagcccctcatcgag
ctcttcgtcaaggccggaagtgatggtgaaagcattggaaactgccccttttcacagagg
ctcttcatgatcctttggctcaaaggagtcgtgttcagtgtcacaaccgttgacctgaaa
aggaaacctgcagatctacagaacttggctcctgggacccacccgccatttataaccttc
aacagcgaagtcaagacggatgtgaataagattgaggaatttctcgaagaagtcttgtgc
ccacccaagtacctaaagctttcaccaaagcacccagagtcgaacactgctggaatggac
atctttgccaaattctctgcttacatcaagaactcaagaccagaggctaatgaagcgctg
gagagggggctcttgaaaacgctgcagaaactggatgagtacctcaactctcccctcccc
gacgaaatcgacgagaacagcatggaggacatcaaattttccacacgtcggtttctggac
ggcgatgagatgacattagcagactgtaacctgctgcccaagctccacattgtcaaggtg
gtggccaaaaaataccgcaactttgatattcctaaaggaatgacaggcatctggaggtac
ctgacaaacgcctacagcagggacgagttcaccaacacctgtcccagcgacaaggaggtg
gaaatcgcgtacagcgatgtcgccaagagacttaccaagtag

DBGET integrated database retrieval system