KEGG   Mus musculus (house mouse): 30794
Entry
30794             CDS       T01002                                 
Symbol
Pdlim4, Ril
Name
(RefSeq) PDZ and LIM domain 4
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    30794 (Pdlim4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   30794 (Pdlim4)
SSDB
Motif
Pfam: PDZ LIM DUF4749 PDZ_6 Peptidase_M50 PDZ_2
Other DBs
NCBI-GeneID: 30794
NCBI-ProteinID: NP_062290
MGI: 1353470
Ensembl: ENSMUSG00000020388
UniProt: P70271
Position
11:complement(53945754..53959858)
AA seq 330 aa
MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPENKNWPSAPDDKAQAHRIHIDPESQDCSPATSRRSSV
SGISLEDNRSGLGSPYGQPPRLPVPHNGSSNEATLPAQMSALHVSPPTSADTARVLPRNR
DCRVDLGSEVYRMLREPAEPTASEPKQSGSFRYLQGMLEAGEGGDRPGSGGPRNLKPAAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCENHAKARVKPPEGYDVVAVYPNAKVELV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgacccactcggtgaccctgcgcggcccttcaccctggggcttccgcctggtgggcggc
cgggacttcagtgctcccctcaccatctcgcgggttcatgctgggagcaaagcggccctg
gctgccctgtgcccaggtgacttgatccaagccatcaacggcgagagcactgagctcatg
acacacctggaggcccagaaccgcattaaaggctgccacgatcatcttacgctctcggtc
agcaggcctgagaataagaactggcccagtgctcctgatgacaaggctcaagcacatagg
atccacattgaccctgagtcccaggactgcagtccagccaccagcaggcgctcctcagtc
tctgggattagtctggaggacaacagatcgggcctgggatctccatatggtcagccacct
cgccttccagtccctcacaatggcagcagcaacgaggccaccctgccagcccagatgagc
gctctgcatgtgtctccacccaccagtgccgacacagccagggttctccctcggaaccgg
gactgcagggtagacctgggttcagaggtatacaggatgttaagggagccagcagagccc
acagcctcggagccgaaacagtcaggatccttccgctacctgcagggcatgctagaggct
ggcgagggcggggatcggcctgggtctggtggtccccggaacctcaaaccagcagccagc
aagctcggtgctccactgagtggcctgcaggggctaccagagtgcacgcgctgcggccac
gggatcgtgggaaccattgtcaaggcgagagacaagctctaccatccggagtgcttcatg
tgcagcgactgcggcctgaatctcaaacagcgtgggtacttcttcctagatgaacggctg
tactgtgagaatcacgccaaggctcgagtcaagccgccggagggatatgatgtggtggct
gtataccccaatgctaaggtggaacttgtctga

DBGET integrated database retrieval system