KEGG   Mus musculus (mouse): 30841Help
Entry
30841             CDS       T01002                                 

Gene name
Kdm2b, Cxxc2, Fbl10, Fbxl10, Jhdm1b, PCCX2
Definition
(RefSeq) lysine (K)-specific demethylase 2B
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    30841 (Kdm2b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    30841 (Kdm2b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     30841 (Kdm2b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     30841 (Kdm2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    30841 (Kdm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD_4 zf-CXXC F-box JHD F-box-like Cupin_8 JmjC PHD LRR_8
Motif
Other DBs
NCBI-GeneID: 30841
NCBI-ProteinID: NP_001003953
MGI: 1354737
Ensembl: ENSMUSG00000029475
Vega: OTTMUSG00000055467
UniProt: Q6P1G2
Position
5; 5 F
AA seq 1309 aa AA seqDB search
MEAEKDSGRRLRAIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD
FNYEYVQREALRVPLVFRDKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEM
SMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQ
TEATNALAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNL
ALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILH
SFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRELMLI
DAPRKTSVDGFSSDSWLDMEEESCEQQPQEEEEEEEDKEEEGDGADKTPKPPTDDPTSPT
STPPEDQDSTGKKPKAPAIRFLKRTLSNESEESVKSTSMPTDDPKTPTGSPATEVSTKWT
HLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHVDDDPTLAITGV
PVVSWPKKTAKNRVVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGEC
HFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLME
CSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGSL
LKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKRKYE
KPQELSGRKRASSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKLFRK
KRRSWKNAEDRLSLANKPLRRFKQEPEDDLPEAPPKTRESDQSRSSSPTAGPSTEGAEGP
EEKKKVKMRRKRRLVNKELSKELSKELNHEIQKTESTLAHESQQPIKSEPESENDEPKRP
LSHCERPHRFSKGLNGTPRELRHSLGPGLRSPPRVMSRPPPSASPPKCIQMERHVIRPPP
ISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRWCCDKRLWTRIDL
NRCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSAL
CSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITD
VSLRLIIRHMPLLSKLQLSYCNHINDQSINLLTAVGTTTRDSLTEVNLSDCNKVTDLCLS
FFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagaaagactctggaagaagattgcgtgcgattgaccgccagagatacgac
gagaacgaagacttgtcggacgtggaggaaattgtcagcgtccgtggcttcagcctggag
gagaagctacgtagccagttataccagggggacttcgtgcatgctatggaaggcaaagat
tttaactatgagtacgtacagagagaagctctcagggtccccctggtttttcgggacaag
gatggactagggatcaagatgccagaccctgatttcacagtccgagacgtcaaactcctg
gtggggagccgccgtttggtggatgtcatggacgtcaacacccagaagggtaccgagatg
agcatgtcccagtttgtgcgctactacgagacaccagaggcacagcgggataaactgtac
aacgtcatcagcctcgagttcagccatacgaagctggagcatctggtcaagcgtcccact
gtggtggacctggtcgactgggtggacaacatgtggcctcagcatctaaaggaaaagcag
acagaagccaccaatgcccttgcagagatgaagtaccccaaagtgaaaaagtactgtctg
atgagcgtgaagggctgtttcactgacttccacattgactttggaggcacctccgtgtgg
taccatgtgttccgtggtggcaagatcttttggctgatccctccaaccctgcacaacttg
gctttgtacgaggagtgggtgctgtctggcaaacagagcgacatctttctgggagaccgc
gtggaacgctgccaaagaattgagctgaagcaaggctacacctttttcatcccttccggt
tggatccatgcggtttatacgcctgtggactctctggtgttcggcgggaacatcctgcat
agcttcaacgtgcccatgcagctgcggatctacgagatcgaggacaggacccgggttcag
cccaagttccgttaccccttctactatgagatgtgctggtatgtcttggagagatatgtg
tactgtgtgacccagcgctcctacctcactcaggaataccagagagaattaatgcttatt
gatgccccaagaaaaaccagtgtagacggcttttcatccgactcctggctggacatggag
gaggagtcctgcgagcagcagccacaggaggaagaggaggaggaggaggacaaggaggag
gaaggagatggtgcagataaaacacccaagccacccaccgatgaccccacctcacccacc
agcaccccgcccgaagaccaggacagcacagggaagaagcctaaagcccctgccatacgg
ttcctcaagaggacgttgtccaatgagtcagaggaaagtgtcaagtcgacctcgatgccc
acggacgatcccaagacgcccacgggctccccggccaccgaggtttctaccaagtggact
caccttaccgaatttgaactgaagggcttgaaagccctggttgaaaagctagagtccctt
ccggagaataagaagtgtgtccctgagggaatcgaggacccccaggccctcctggaaggt
gtaaagaatgtactgaaagagcacgtggatgacgaccccaccctggccatcaccggggtc
cctgtggtcagctggccaaagaaaactgcaaagaaccgggtggtgggtcggcctaagggc
aagttgggcccggcctcagcggtgaagttggctgccaaccgaacaacagcaggagctcgc
aggcgccggacgcgatgccgcaagtgcgaggcctgcctgcggacggagtgtggagagtgc
cacttttgcaaggacatgaagaagtttggaggtcctgggcgcatgaagcagagctgcatc
atgcggcagtgcatcgcgccagtgctgccccacaccgccgtgtgccttgtgtgtggcgag
gcagggaaggaggacacagtggaagaggaagaaggcaagtttaacctcatgctcatggaa
tgctccatctgcaacgagatcatccaccctggatgccttaagattaaggaatcggagggt
gtggtcaacgatgagcttcccaactgctgggagtgtccgaagtgtaaccatgccggcaag
accgggaaacaaaagcgtggccctggctttaagtatgcctccaacctgcctggctccttg
ctcaaggagcagaagatgaaccgggacaacaaggaagggcaagagcctgccaagcggaga
agtgagtgtgaagaggctccccgtcggaggtcagacgagcaccccaaaaaggtgcctgca
gatggcatcctccgccgaaagtctgatgatgtgcacctgaggaggaagcggaaatacgag
aagccccaagagctgagtggacgcaagcgagcctcgtcgcttcaaacgtcccccggttcc
tcctctcacctctcgccgaggccccctctaggcagcagtctcagcccttggtggagatcc
agtctcacttacttccagcagcagctaaaacctggcaaagaagataagcttttcaggaaa
aagcggcggtcctggaagaacgctgaggatcgtctgtcactggccaacaagccccttcgg
cgctttaagcaggaaccggaggacgatctgcctgaggcacctcctaagacccgggagagt
gatcagtcacgttccagctcacccactgctggtcccagcactgagggagctgaaggccca
gaagagaagaaaaaggtgaagatgcgccggaagcggcgacttgttaacaaggagctgagc
aaagagctaagcaaggagctcaaccatgagatccaaaagacggagagcaccctggctcac
gagagccagcagcccatcaagtcagagcctgagagcgagaacgacgagcccaagaggccc
ttaagccactgcgagcgcccccaccgcttcagcaaagggctcaacggcacacctcgggag
ctgcggcactcgctgggacctggcctgcgtagtccacctcgtgttatgtcccggcccccg
ccctctgcatccccacccaagtgcatccagatggagcgtcacgtgatccggccaccgccc
atcagccccccacctgactcgctgcccctggatgatggagcagcccacgtcatgcatagg
gaggtgtggatggcagtcttcagctacctcagccaccgagacctgtgtgtctgcatgcgg
gtctgcaggacctggaaccgctggtgctgcgataagcggttgtggacccgcatcgacctg
aaccgctgcaagtccatcacacccctgatgctgagcggtatcatccggcgacagcctgtc
tcccttgacctcagttggaccaacatctccaagaagcagctgagttggctcatcaaccgg
ttgcctgggctccgagacttggtgctgtcaggctgctcatggatcgctgtctcagccctc
tgtagctccagttgtccattgctccggaccctggatgtccagtgggtagaaggactaaag
gatgcccagatgagggatctcctgtctccacccacagacaacaggccaggtcagatggac
aatcggagcaagctccggaacattgtagagctgcgcctagctggcctggacatcacagat
gtctccctgcggctcattattcgccatatgcccctgctctcgaagctccaactcagttac
tgtaaccacatcaatgaccagtccatcaacctgctcactgccgtcggcaccaccacccga
gactcgctgacagaggtcaacctatcagactgtaataaggtaactgacctgtgcctgtcc
ttcttcaaacgctgtggaaatatctgtcatattgacctgaggtactgcaagcaagtcacc
aaggaaggctgtgagcaattcatagctgaaatgtctgtgagtgtccaatttgggcaagtg
gaagagaaactcctgcaaaaactaagttag

DBGET integrated database retrieval system