KEGG   Mus musculus (mouse): 30878
Entry
30878             CDS       T01002                                 

Gene name
Apln, 6030430G11Rik, Apel
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    30878 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    30878 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 30878
NCBI-ProteinID: NP_038940
MGI: 1353624
Ensembl: ENSMUSG00000037010
Vega: OTTMUSG00000017506
UniProt: Q9R0R4 Q544B5
Position
X; X A5
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgaggctctgcgtgcaggcgctgctgctgctctggctctccttgactgcagtt
tgtggagtgccactgatgttgcctccagatggaacaggactagaagaaggaagcatgcgc
tacctggtgaagcccagaacttcgaggactggaccaggagcctggcagggaggcaggagg
aaatttcgcagacagcgcccccggctctcccataagggccccatgcctttctaa

DBGET integrated database retrieval system