KEGG   Mus musculus (mouse): 30924
Entry
30924             CDS       T01002                                 

Gene name
Angptl3, hy, hypl
Definition
(RefSeq) angiopoietin-like 3
  KO
K22288  angiopoietin-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    30924 (Angptl3)
SSDB
Motif
Pfam: Fibrinogen_C Crescentin AAA_13 DUF3829 DUF1664 Sec34 DUF4494 PI_PP_I Uds1 Allexi_40kDa USP8_interact
Other DBs
NCBI-GeneID: 30924
NCBI-ProteinID: NP_038941
MGI: 1353627
Ensembl: ENSMUSG00000028553
Vega: OTTMUSG00000008051
UniProt: Q9R182 Q3UEF5
Position
4 C6; 4 45.6 cM
AA seq 455 aa
MHTIKLFLFVVPLVIASRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDF
VHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVEL
NSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQ
SVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRAPRTTPPLQLNETENTEQD
DLPADCSAVYNRGEHTSGVYTIKPRNSQGFNVYCDTQSGSPWTLIQHRKDGSQDFNETWE
NYEKGFGRLDGEFWLGLEKIYAIVQQSNYILRLELQDWKDSKHYVEYSFHLGSHETNYTL
HVAEIAGNIPGALPEHTDLMFSTWNHRAKGQLYCPESYSGGWWWNDICGENNLNGKYNKP
RTKSRPERRRGIYWRPQSRKLYAIKSSKMMLQPTT
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgcacacaattaaattattcctttttgttgttcctttagtaattgcatccagagtggat
ccagacctttcatcatttgattctgcaccttcagagccaaaatcaagatttgctatgttg
gatgatgtcaaaattttagcgaatggcctcctgcagctgggtcatggacttaaagatttt
gtccataagactaagggacaaattaacgacatatttcagaagctcaacatatttgatcag
tctttttatgacctatcacttcgaaccaatgaaatcaaagaagaggaaaaggagctaaga
agaactacatctacactacaagttaaaaacgaggaggtgaagaacatgtcagtagaactg
aactcaaagcttgagagtctgctggaagagaagacagcccttcaacacaaggtcagggct
ttggaggagcagctaaccaacttaattctaagcccagctggggctcaggagcacccagaa
gtaacatcactcaaaagttttgtagaacagcaagacaacagcataagagaactcctccag
agtgtggaagaacagtataaacaattaagtcaacagcacatgcagataaaagaaatagaa
aagcagctcagaaagactggtattcaagaaccctcagaaaattctctttcttctaaatca
agagcaccaagaactactccccctcttcaactgaacgaaacagaaaatacagaacaagat
gaccttcctgccgactgctctgccgtttataacagaggcgaacatacaagtggcgtgtac
actattaaaccaagaaactcccaagggtttaatgtctactgtgatacccaatcaggcagt
ccatggacattaattcaacaccggaaagatggctcacaggacttcaacgaaacatgggaa
aactacgaaaagggctttgggaggctcgatggagaattttggttgggcctagagaagatc
tatgctatagtccaacagtctaactacattttacgactcgagctacaagactggaaagac
agcaagcactacgttgaatactcctttcacctgggcagtcacgaaaccaactacacgcta
catgtggctgagattgctggcaatatccctggggccctcccagagcacacagacctgatg
ttttctacatggaatcacagagcaaagggacagctctactgtccagaaagttactcaggt
ggctggtggtggaatgacatatgtggagaaaacaacctaaatggaaaatacaacaaaccc
agaaccaaatccagaccagagagaagaagagggatctactggagacctcagagcagaaag
ctctatgctatcaaatcatccaaaatgatgctccagcccaccacctaa

DBGET integrated database retrieval system