KEGG   Mus musculus (mouse): 30926
Entry
30926             CDS       T01002                                 

Symbol
Glrx3, PICOT, Txnl2
Name
(RefSeq) glutaredoxin 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Glutaredoxin Thioredoxin Thioredoxin_2 Phosducin SH3BGR DIM1 HyaE OST3_OST6 GREB1_C Thioredoxin_9 DUF953 TMF_TATA_bd TrbC_Ftype
Other DBs
NCBI-GeneID: 30926
NCBI-ProteinID: NP_075629
MGI: 1353653
Ensembl: ENSMUSG00000031068
Vega: OTTMUSG00000060317
UniProt: Q9CQM9
Structure
Position
7:137039302..137071360
AA seq 337 aa
MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAK
EHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSS
GAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSS
FDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEER
LKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSN
WPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggcgggggcggccgaggcaggcgaggcagccgtggcagtggtggaagtcggctct
gcccagcagtttgaagagctactgcgcctcaaaaccaagtcactccttgtggttcatttc
tgggcaccatgggctccacagtgtgtacagatgaacgatgtcatggcagagttagctaaa
gaacaccctcatgtttcatttgtgaagctggaagccgaagctgttcctgaagtatctgaa
aaatatgaaattagctctgtccccaccttcctgttcttcaagaattctcagaaagtcgac
cggttagatggtgcacatgccccagagttgaccaaaaaagtccagcgacacgtgtctagc
ggagcctttcctcctagtactaatgaacatcttaaagaagacctcagccttcgcctgaaa
aagctgactcacgctgccccctgcatgctgttcatgaagggaacacctcaagaaccacgc
tgtggtttcagcaagcagatggtggaaatccttcacaaacacaatattcagttcagcagc
tttgatatcttctcagatgaagaagttcgacaggggctcaaaacgtactctaattggccc
acctatcctcagctctatgtttctggagagctaataggaggacttgacataattaaggag
ctggaagcatcagaagagctggacacgatctgtcccaaagcacccaagttagaggaaagg
ctcaaagtgctgaccaataaagcttccgtgatgctctttatgaaaggaaacaaacaggaa
gcaaaatgtggattcagcaaacaaattctggaaatactgaatagtactggggttgaatat
gaaacttttgatatactggaagatgaagaagtgcgtcagggattaaaaacgttctcaaat
tggccaacctaccctcagctgtatgtgagaggggatcttgttggaggattggatattgtc
aaggaactgaaagacaacggtgaattgctgcctatactgaaaggagaaaattag

DBGET integrated database retrieval system