KEGG   Mus musculus (house mouse): 30926
Entry
30926             CDS       T01002                                 
Symbol
Glrx3, PICOT, Txnl2
Name
(RefSeq) glutaredoxin 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Glutaredoxin SH3BGR DUF4279 TMF_TATA_bd Arf
Other DBs
NCBI-GeneID: 30926
NCBI-ProteinID: NP_001335022
MGI: 1353653
Ensembl: ENSMUSG00000031068
Position
7:137039302..137071360
AA seq 189 aa
MLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVS
GELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQ
ILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGE
LLPILKGEN
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctgttcatgaagggaacacctcaagaaccacgctgtggtttcagcaagcagatggtg
gaaatccttcacaaacacaatattcagttcagcagctttgatatcttctcagatgaagaa
gttcgacaggggctcaaaacgtactctaattggcccacctatcctcagctctatgtttct
ggagagctaataggaggacttgacataattaaggagctggaagcatcagaagagctggac
acgatctgtcccaaagcacccaagttagaggaaaggctcaaagtgctgaccaataaagct
tccgtgatgctctttatgaaaggaaacaaacaggaagcaaaatgtggattcagcaaacaa
attctggaaatactgaatagtactggggttgaatatgaaacttttgatatactggaagat
gaagaagtgcgtcagggattaaaaacgttctcaaattggccaacctaccctcagctgtat
gtgagaggggatcttgttggaggattggatattgtcaaggaactgaaagacaacggtgaa
ttgctgcctatactgaaaggagaaaattag

DBGET integrated database retrieval system