KEGG   Mus musculus (mouse): 30926Help
Entry
30926             CDS       T01002                                 

Gene name
Glrx3, PICOT, Txnl2
Definition
(RefSeq) glutaredoxin 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaredoxin Thioredoxin Thioredoxin_2 Phosducin DIM1 SH3BGR HyaE OST3_OST6 Thioredoxin_9 DUF953
Motif
Other DBs
NCBI-GeneID: 30926
NCBI-ProteinID: NP_075629
MGI: 1353653
Ensembl: ENSMUSG00000031068
Vega: OTTMUSG00000060317
UniProt: Q9CQM9
Structure
PDB: 

Position
7; 7 F4
AA seq 337 aa AA seqDB search
MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAK
EHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSS
GAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSS
FDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEER
LKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSN
WPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggggcggccgaggcaggcgaggcagccgtggcagtggtggaagtcggctct
gcccagcagtttgaagagctactgcgcctcaaaaccaagtcactccttgtggttcatttc
tgggcaccatgggctccacagtgtgtacagatgaacgatgtcatggcagagttagctaaa
gaacaccctcatgtttcatttgtgaagctggaagccgaagctgttcctgaagtatctgaa
aaatatgaaattagctctgtccccaccttcctgttcttcaagaattctcagaaagtcgac
cggttagatggtgcacatgccccagagttgaccaaaaaagtccagcgacacgtgtctagc
ggagcctttcctcctagtactaatgaacatcttaaagaagacctcagccttcgcctgaaa
aagctgactcacgctgccccctgcatgctgttcatgaagggaacacctcaagaaccacgc
tgtggtttcagcaagcagatggtggaaatccttcacaaacacaatattcagttcagcagc
tttgatatcttctcagatgaagaagttcgacaggggctcaaaacgtactctaattggccc
acctatcctcagctctatgtttctggagagctaataggaggacttgacataattaaggag
ctggaagcatcagaagagctggacacgatctgtcccaaagcacccaagttagaggaaagg
ctcaaagtgctgaccaataaagcttccgtgatgctctttatgaaaggaaacaaacaggaa
gcaaaatgtggattcagcaaacaaattctggaaatactgaatagtactggggttgaatat
gaaacttttgatatactggaagatgaagaagtgcgtcagggattaaaaacgttctcaaat
tggccaacctaccctcagctgtatgtgagaggggatcttgttggaggattggatattgtc
aaggaactgaaagacaacggtgaattgctgcctatactgaaaggagaaaattag

DBGET integrated database retrieval system