KEGG   Mus musculus (mouse): 30930
Entry
30930             CDS       T01002                                 

Symbol
Vps26a, AA407240, HB58, Vps26
Name
(RefSeq) VPS26 retromer complex component A
  KO
K18466  vacuolar protein sorting-associated protein 26
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30930 (Vps26a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    30930 (Vps26a)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    30930 (Vps26a)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 30930
NCBI-ProteinID: NP_598433
MGI: 1353654
Ensembl: ENSMUSG00000020078
UniProt: P40336
Structure
Position
10:complement(62290622..62322584)
AA seq 327 aa
MSFLGGFFGPICEIDVALNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
KLRKQRTNFHQRFESPDSQASAEQPEM
NT seq 984 nt   +upstreamnt  +downstreamnt
atgagttttcttggaggcttttttggtcccatttgtgagattgatgttgcccttaatgat
ggggaaaccaggaaaatggcagaaatgaaaactgaggatggcaaagtagaaaaacactat
ctcttctatgatggcgagtctgtctcaggaaaggtaaacctagcctttaagcagcctgga
aagaggctagagcatcaaggaattagaattgaatttgtaggtcaaattgagcttttcaat
gacaagagtaatactcatgaatttgtaaacctagtgaaggaactagccttgcctggagaa
ctgactcagagcagaagctatgactttgaatttatgcaagttgaaaagccatatgagtca
tacatcggtgccaatgtccgcctgaggtattttcttaaggtgacaattgtgagaagattg
acagacttagtgaaagagtacgatcttattgttcatcagctagccacctatcctgatgtc
aacaactctattaaaatggaagtgggcattgaagactgtctgcacatagagtttgaatat
aataagtccaagtatcatttaaaggatgtaattgttggaaaaatttacttcttattagta
agaataaaaatacaacacatggaattacagctgatcaagaaagagatcacaggaattgga
cccagcaccacaacagagacagaaacaatcgctaagtatgaaataatggatggggcgcca
gtaaaaggagaatctattccgataagattgttcttagcagggtatgacccaacccccacg
atgagagatgtgaacaagaagttttcagtaaggtactttctaaacctcgtgcttgttgat
gaggaggaccgaaggtacttcaagcagcaggagatcatcctgtggagaaaagcacccgag
aaactgagaaaacagaggacgaactttcaccagcggtttgaatctccagactcgcaggcc
tctgcggagcagcctgagatgtaa

DBGET integrated database retrieval system