KEGG   Mus musculus (mouse): 30932
Entry
30932             CDS       T01002                                 

Gene name
Zfp330, BC008086, No, Noa36, Znf330
Definition
(RefSeq) zinc finger protein 330
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: NOA36 RXT2_N
Other DBs
NCBI-GeneID: 30932
NCBI-ProteinID: NP_663575
MGI: 1353574
Ensembl: ENSMUSG00000031711
Vega: OTTMUSG00000061382
UniProt: Q922H9
Position
8; 8 C2
AA seq 316 aa
MPKKKTGARKKAENRREREKQLRASRSTVDLAKHPCNASMECDKCQRRQKNRAFCYFCNS
VQKLPICAQCGKTKCMMKSSDCVIKHAGVYSTGLAMVGAICDFCEAWVCHGRKCLSTHAC
ACPLTDAECVECERGVWDHGGRIFSCSFCHNFLCEDDQFEHQASCQVLEAETFKCVSCNR
LGQHSCLRCKACFCDEHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQTG
GEEDGASGYDAYWKNLSSDKYGDTGYHDDDEEEDEAEDEEEEDGKDSDAESSDLFNNLNL
GRTYASGYAHYEEQES
NT seq 951 nt   +upstreamnt  +downstreamnt
atgccgaagaaaaagaccggtgcgaggaagaaggcagagaaccgccgagaacgcgagaaa
caactgcgagcatcaagaagtactgtcgacctagccaaacacccatgcaatgcttcaatg
gaatgcgacaaatgtcagaggcggcagaagaatagagcattttgctatttttgtaattct
gttcagaagttaccaatttgtgcacagtgtgggaaaacaaagtgtatgatgaagtcgtca
gactgtgttatcaagcatgctggtgtgtacagtactggccttgctatggtgggtgcaata
tgtgacttctgcgaagcttgggtttgccatgggaggaagtgtcttagcacccatgcctgt
gcctgcccactcacagatgcagagtgtgtggaatgtgagcgaggggtatgggaccatgga
ggaagaatattcagctgttcgttttgccataattttctctgtgaagatgaccagtttgag
catcaagccagctgccaagttttagaagcagaaacatttaaatgtgtttcctgcaatcga
cttggccagcattcatgtctccgctgtaaggcttgtttctgtgatgaacatacaaggagc
aaagtgtttaagcaagaaaaaggaaaacaacctccttgccctaaatgtgggcatgaaaca
caggagacaaaggatcttagcatgtcaacacgctccttgaaatttggcaggcagactgga
ggagaagaagatggagcctcagggtatgatgcttactggaagaacctgtcgtcggacaag
tatggagatactggataccatgatgatgatgaggaggaggatgaagcagaggatgaagag
gaagaagatgggaaggactcagatgctgagtcatcagatctgttcaataacttgaattta
ggaaggacctatgccagtggctacgctcactacgaggagcaggagagctag

DBGET integrated database retrieval system