KEGG   Mus musculus (mouse): 30942Help
Entry
30942             CDS       T01002                                 

Gene name
Hnf4g, NR2A2
Definition
(RefSeq) hepatocyte nuclear factor 4, gamma
  KO
K08037  hepatocyte nuclear factor 4-gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    30942 (Hnf4g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    30942 (Hnf4g)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    30942 (Hnf4g)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    30942 (Hnf4g)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   30942 (Hnf4g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 30942
NCBI-ProteinID: NP_038948
MGI: 1353604
Ensembl: ENSMUSG00000017688
Vega: OTTMUSG00000020282
UniProt: Q9WUU6 Q059V1 Q3UP48
Position
3; 3 A1
AA seq 418 aa AA seqDB search
MDSSAPETTSMNTTDSGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRF
SRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIPSINTLAQA
EVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVA
LLRAHAGEHLLLGATKRSMMYKDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEI
QIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLL
LLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGAANDGSHLHHPMHPHLSQDPLT
GQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEPYKITANQASVISHQSLSKQKQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggacagttctgccccagagaccacaagtatgaataccacagacagtggtgtcaactgt
ttatgtgccatctgtggtgacagagcaacaggaaagcactatggggcatccagttgtgat
ggctgcaaaggctttttcaggcgcagcattcggaagagtcatgtttattcctgcaggttc
agtcggcagtgtgttgttgacaaggacaaaaggaatcaatgcagatactgtcgattaaga
aagtgttttagagcaggaatgaaaaaagaagcggtgcaaaatgaacgcgacagaatcagt
acaagaagaagtacctacgagggcagcaacatcccctccataaacactctggcacaagcg
gaagtgaggtcttgccagatttcagtcccaagccccagttccagcactgacataaatatt
aagaaaatcgcaagcatcagtgacgtttgtgagtccatgaaacaacagctcttagtcttg
gtggaatgggccaaatacatccctgccttctgtgaactgcccttggatgaccaggtggcc
ctcttgagagcccatgctggagaacatctgctgcttggagctacaaagagatccatgatg
tataaagatattttgcttttgggaaaccactatgttattcaccgcaacagctgtgaagtt
gaagtcagtcgtgtagccaacagagttctcgatgagctggttagacccttccaagagatc
cagatagatgacaacgagtacgcgtgcttgaaggccattgtgttttttgacccagatgca
aagggattgagtgaccctgtgaagattaagaacatgcggttccaggtgcagatcagcttg
gaggactacatcaatgaccggcagtatgactctcgtggcaggtttggagagctgctgttg
ctgctgccaacactgcagagcattacctggcagatgattgaacaaattcagttcgtcaaa
ctgttcggcatggtcaaaattgacaacctccttcaggaaatgctgctgggtggtgctgcc
aatgatggtagtcatctccatcatccaatgcacccacatttatctcaagatccactaact
gggcaaactatacttttaggtcccatgtccacactggttcatacagaccagattgcaact
ccagagaccccactcccttccccaccacaaggctctggacaagaaccgtacaaaattact
gcaaatcaagcttcagtcatttcacatcaatccctctctaagcaaaagcagctgtga

DBGET integrated database retrieval system