KEGG   Mus musculus (mouse): 30957
Entry
30957             CDS       T01002                                 

Symbol
Mapk8ip3, BB120594, D17Wsu15e, JIP-3, JSAP1, JSAP1a, JSAP1b, JSAP1c, JSAP1d, Jip3, Syd2, mKIAA1066
Name
(RefSeq) mitogen-activated protein kinase 8 interacting protein 3
  KO
K04436  mitogen-activated protein kinase 8 interacting protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30957 (Mapk8ip3)
SSDB
Motif
Pfam: Jnk-SapK_ap_N WD40_2 JIP_LZII Taxilin Atg14 ERM
Other DBs
NCBI-GeneID: 30957
NCBI-ProteinID: NP_038959
MGI: 1353598
Ensembl: ENSMUSG00000024163
Vega: OTTMUSG00000030477
UniProt: Q9ESN9 Q3UHB5 Q3UYC3
Structure
PDB: 
6EJN

Position
17 A3.3; 17 12.53 cM
AA seq 1337 aa
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLG
QLQSSSSYQCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYV
SVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRL
ERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKE
VGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKEL
EEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYK
ERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIH
YKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDG
RLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWK
PHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEKKKAKETPEADATSSRVWILTST
LTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDSGA
DGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVATTANGKVNPSQSTEEATEAT
EVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSSTQPASENGSESNGTIVQPQVEPSGE
LSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADG
TLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEK
SFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTR
PGGIIHVYGDDSSDKAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLD
SPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRIGDGEDDETEECAGDVNQTKPSLS
KAERSHIIVWQVSYTPE
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgatggagatccagatggacgagggaggaggagtggtggtgtaccaagacgactactgc
tcgggctcggtcatgtcggagcgtgtgtcgggcctggcgggctccatctaccgcgagttc
gagcgcctcattcactgctatgacgaggaggtggtcaaggagctcatgccgctggtggtg
aacgtgctggagaaccttgactcggtgctgagcgagaaccaggagcacgaggtggagctg
gagctcctacgcgaggacaacgagcagctgctcacgcaatacgagcgcgagaaggcgctg
cgcaaacaggccgaggagaaattcatcgaatttgaagatgccttggaacaagagaagaaa
gaactccagatccaggtagaacattatgagtttcagacacgccagctggagctaaaggcc
aaaaactatgcagatcagatttcccgactggaggaacgagaatcggagatgaagaaggaa
tacaatgccctgcaccagcggcacacagagatgatccagacctatgtggaacacattgaa
agatccaagatgcagcaagttgggggtagcggccaaacagaaagcagcctgcccgggcgg
agcaggaaggagcgtcccacctctctgaatgtcttccccctggctgatggcatggtacgt
gcacagatggggggcaagctcgtgcctgcgggggaccactggcacctgagtgacctcggc
cagctacagtccagctccagctaccagtgtccaaatgatgagatgtctgagtcaggccag
tcctcagcagctgcaacacccagtaccacaggtaccaagtccaacacacccacgtcctcc
gtgccctcagcagcagtcacgccactcaacgagagcctacagcccctgggggactatgtc
agtgtcacaaagaacaacaagcaggcccgagagaagcgcaatagccgtaacatggaggtc
caggtcacccaagagatgcggaacgtcagtatcggcatgggcagcagtgacgagtggtcc
gatgttcaggacattatcgactccaccccagagctggatgtgtgtcctgaaacccgtctg
gagcgcacaggaagcagcccaacccagggaattgtaaacaaagcttttggaatcaacact
gactccttgtatcacgaactctccacggcgggatctgaggtcatcggggatgtggacgag
ggagctgatctcctaggggagttttcagtgcgcgatgatttttttggaatgggcaaagaa
gtggggaacctgctgctggagaactcacagcttctagagacaaaaaatgctttaaatgta
gtgaagaatgacctcattgctaaggttgaccaactgtcaggagaacaggaggtcctgaag
ggtgagctggaagcagccaagcaagccaaagtcaagctggagaaccgaatcaaagagctt
gaagaagaactgaagagagtcaagtcagaggcagtaactgcccgccgtgagcccagagaa
gaggtggaggatgtaagcagctatctctgtacagaattggacaaaatccccatggcccag
cgccgacgcttcacacgggtggagatggcccgagtgctcatggaacgcaaccagtacaag
gaacgcctcatggagctgcaggaggctgtgaggtggactgaaatgatcagagcatcaagg
gaacacccatctgtccaggagaagaagaagtccaccatctggcagttctttagtcgcctc
ttcagctcctcatctagcccccctccggccaaacgatcctacccatctgtgaacattcac
tacaagtcacccactgcagctggctttagccagcgtcgcagccatgctttgtgccagatc
tcagccggcagcaggcccctggagttcttccctgatgatgactgcacctcttctgcccgg
cgggagcagaagcgggagcagtaccgccaggttcgtgaacacgtgcgcaatgatgacggg
aggctgcaggcctgtgggtggagcctgcctgccaagtacaagcagctgagccccaatgga
ggccaggaagacacccggatgaaaaatgtgcctgtccctgtgtactgccgccctctggtg
gagaaggacccttcgacaaagctgtggtgtgctgctggtgtcaacctgagtgggtggaag
ccacatgaagaggactctagcaatggacccaagcctgtaccaggtcgagaccctctgacc
tgtgaccgggaaggagaaggcgaacccaagagcacacacccatcacctgagaagaagaag
gcaaaggaaacccctgaggcagatgctacctccagtcgggtatggatcctcaccagcacc
ctgacaaccagcaaggtggtgatcattgatgccaaccagccaggcacaattgtggatcag
ttcacagtctgcaatgcccacgtcctgtgtatctccagcattcctgcggccagtgacagt
gactatccccctggggagatgttcctagacagtgatgtgaaccctgaagattcaggtgct
gatggtgtgctggctggcatcaccctggtggggtgtgctacccgctgcaatgttccacgt
agcaactgttcctcacgaggagacaccccagtactggacaaggggcagggggatgtggcg
accactgccaatgggaaggtcaacccgtcccaatccacagaagaagccacagaagccacg
gaggtgccagaccctggtcccagcgagtcagaagcaacgacagtccggcccgggcctctc
acagagcatgtctttactgacccagcacccaccccatcctccagcacccagcctgccagt
gagaatgggtcagagtccaatggcaccattgtacagcctcaggtggagcccagtggggaa
ctctcaacaacaaccagtagcgctgcacccactatgtggctaggagcccagaatggctgg
ctctatgtgcattcagcggtagccaactggaagaagtgtctgcactccatcaagctaaaa
gactctgtgctgagcctggtgcatgtcaaaggccgagtgctggtagctcttgcagatggg
accctggctatcttccatcgtggagaggatggccagtgggacctgagcaactaccaccta
atggacctgggccacccacaccactccatccgctgcatggctgttgtgaatgaccgagtt
tggtgtggctacaagaacaaggtgcatgttatccagcccaagacaatgcagattgagaaa
tcatttgatgcccacccaaggcgggaaagccaggtacgtcagctggcctggatcggtgat
ggagtgtgggtctctattcgcttggattctacccttcggctctaccatgctcacacccac
cagcacctgcaggatgtggacattgagccctatgttagcaagatgctaggaaccggcaag
ctgggcttctccttcgtgcgcatcacagccttactcattgcaggcaaccgtctgtgggtg
ggcactggcaatggggttgtcatctccatccccttgactgagactgtggtcctgcatcga
ggccagctcctagggctccgagccaacaagacatccccaacatctggggaggggacccgc
ccagggggcatcatccatgtgtatggggacgacagcagtgacaaggccgccagtagtttc
atcccctactgctccatggcacaggctcagctttgcttccatgggcaccgtgatgctgtc
aaattctttgtctctgtgccaggaaatgtgctggccactctcaatggcagtgtgctagac
agcccatcagagggccctgggcctgctgcacccgctgcagatgctgagggccagaagttg
aagaatgcactggtgctgagtggtggtgaaggttacattgacttccgtatcggagacgga
gaggatgatgaaactgaggaatgtgccggggacgtgaaccagacaaagccctcgttgtcc
aaggctgagcgcagccacatcatcgtgtggcaggtgtcctacacccctgagtga

DBGET integrated database retrieval system