KEGG   Mus musculus (mouse): 30960Help
Entry
30960             CDS       T01002                                 

Gene name
Vapa, 33kDa, VAP33
Definition
(RefSeq) vesicle-associated membrane protein, associated protein A
  KO
K06096  vesicle-associated membrane protein-associated protein A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    30960 (Vapa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    30960 (Vapa)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    30960 (Vapa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm bZIP_1 YabA ASH UL45 GIT_CC
Motif
Other DBs
NCBI-GeneID: 30960
NCBI-ProteinID: NP_038961
MGI: 1353561
Ensembl: ENSMUSG00000024091
UniProt: Q9WV55
Structure
PDB: 

Position
17; 17 E1.1
AA seq 249 aa AA seqDB search
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcctccggggccatggcgaagcacgagcagatcctggtcctcgaccctcct
tcagacctcaaattcaaaggccccttcacagatgtagtcactacaaatcttaaattgcaa
aatccatcggatagaaaagtgtgtttcaaagtgaagactacagcacctcgccggtactgt
gtgcggcccaacagtgggattattgacccggggtcaattgtgactgtttcagtaatgctg
caaccctttgattatgatccgaatgaaaagagtaaacataagttcatggtacagacaatt
tttgctccaccaaacatttcagatatggaagctgtgtggaaagaagcaaaacctgatgaa
ttaatggattctaaattgagatgtgtgtttgaaatgccgaatgaaaatgataagctgaat
gatatggaacctagcaaagctgttccactgaatgcatccaaacaagacggacccctgcca
aaaccacacagtgtttcactcaatgatacggaaacaaggaaactgatggaagagtgcaag
cgactccagggagaaatgatgaagctctcagaagaaaaccgacacctgagagatgaaggc
ctaaggctcagaaaggtagcacattcggataaacctggatccacctcagccgtgtccttc
agagataatgtcaccagtcctcttccttctcttctggttgtaattgcagccattttcatt
ggattctttctagggaaattcatcttgtag

DBGET integrated database retrieval system