KEGG   Mus musculus (mouse): 317653
Entry
317653            CDS       T01002                                 

Symbol
Klk14, GK14
Name
(RefSeq) kallikrein related-peptidase 14
  KO
K09622  kallikrein 14 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    317653 (Klk14)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     317653 (Klk14)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   317653 (Klk14)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 317653
NCBI-ProteinID: NP_777355
MGI: 2447564
Ensembl: ENSMUSG00000044737
Vega: OTTMUSG00000027218
UniProt: Q8CGR5 A0A0B6VSR0
Position
7:43330305..43344960
AA seq 250 aa
MFLLLIILQALAVAIAQSQGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQW
VITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKV
RLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPG
IITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYH
SWIQRTMQSN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgttccttctactgatcatactccaagccttggctgtagccatagcccagagccaagga
gatcataaaattattggtggctacagatgtgtccggaactcccagccatggcaggtcgct
ctgcaagcagggcctgggcatcgcttcctgtgtggaggagtcctgttgtcagatcaatgg
gtcatcactgctgctcattgtgcccgcccgattcttcatgtagccctgggcaagcacaac
ataagaaggtgggaagcgactcagcaggtggtgcgtgtggcccgccaggtgccacatccc
cagtatcaaccccaggcccacgataatgacctcatgctgctgaagctgcagaaaaaggtg
cggctgggacgagcagtgaagaccatctctgtggccagctcctgtgccagcccagggact
ccctgccgagtgtcgggctggggaaccatagccagtcccattgccaggtaccccactgct
ctgcagtgtgtgaatgtcaacatcatgtcggagcaggcatgccatcgagcctaccctgga
atcataacatctggcatggtctgtgctggggtccccgaaggcgggaaggactcctgtcag
ggtgattctgggggacccctggtgtgtgggggacagctccagggccttgtgtcctgggga
atggaacgttgtgctatgcctggctacccaggagtctacgccaacctgtgcaattaccac
agctggatccagaggacaatgcaaagcaactga

DBGET integrated database retrieval system