KEGG   Mus musculus (mouse): 317677
Entry
317677            CDS       T01002                                 

Gene name
C1s2, C1sb, EG317677, Gm5077
Definition
(RefSeq) complement component 1, s subcomponent 2
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    317677 (C1s2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    317677 (C1s2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    317677 (C1s2)
   05150 Staphylococcus aureus infection
    317677 (C1s2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    317677 (C1s2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    317677 (C1s2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    317677 (C1s2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     317677 (C1s2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   317677 (C1s2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    317677 (C1s2)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 EGF hEGF HRM
Other DBs
NCBI-GeneID: 317677
NCBI-ProteinID: NP_776289
MGI: 3644269
Ensembl: ENSMUSG00000079343
Vega: OTTMUSG00000028980
UniProt: Q8CFG8 A0A1W2P7F1
Position
6; 6 F2
AA seq 694 aa
MGKSPGMWYLVLFSLLASFSAEPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYF
THVDIEPSESCAYDSVQIISGGIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDF
SIEEQFTGFAAYYTAIDVNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVN
CSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNC
PDSLTFAAKNQQFGPYCGDGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISC
PKESTANSNWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKC
QPVYCGIPDPIANGKVEEPENSVFGTVIHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQL
GIELPRCIPVCGVPTEPFQVQQKIFGGQPAKIENFPWQVFFNHPTAGGALINEYWVLTAA
HVVEKNSDPSMYAGITALRLADLENAQRLYTKRVIIHPGWKEDDDLNPRTNFDNDIALVQ
LKDPVKMGPKFSPICLPGTSSEYNLSPGDMGLISGWGRTEKRLHVINLRGAKVPVTSLET
CKQVKEENPTARPEDYVITDNMICAGEKGVDSCKGDSGGAFAFQVPNVKAPKFYVAGLVS
WGKKCGAYGVYTKVKNYVDWILKTMQENSGPRKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagggatgtggtatttggtcctgttttctcttttggcatcattttct
gctgagcccaccatgcatggggagatcctgtcccctaactatccccaggcgtaccccaat
gacgtcgtgaaatcttgggacattgaagtcccagaggggtttgggattcacctttacttt
acccatgtggacatagagccgtcagagagctgtgcatacgactcagtgcagataatctca
ggaggcatcgaggaagggagactctgtggtcagaggaccagcaagagccccaactccccc
attatagaagagtttcagttcccatacaataaacttcaggtggtctttacctcagacttc
tccatcgaagaacagtttaccggctttgcagcatactacactgccatagacgtaaacgaa
tgcacagattttacagatgtcccctgtagccacttctgcaataacttcattggtggatac
ttctgctcctgtcccccagaatacttcctccatgatgacatgaggaattgtggagtcaac
tgtagtggagatgtgttcactgccctgattggggagatctcaagtcccaattatcccaat
ccatacccggagaactcaaggtgtgaataccagattcaactgcaggagggcttccaagtg
gtggtgacgatgcagagagaagattttgatgtggagcccgctgactcagaggggaactgc
cctgacagtttaacttttgctgcaaaaaaccaacagtttggtccttactgtggcgatggg
tttcctggaccgctaactattagaacccagagcaatactctcggcattgtctttcaaact
gatctaatggggcaaaaaaagggttggaagcttcgttaccatggagatcccatctcctgt
cctaaagaaagcactgccaattctaattgggagcccgataaggcaaaatacgtgtttaaa
gatgtggtgaagataacctgtgtggacggatttgaagttgtggagggacatgttagctct
acttcatactattccacttgtcaaagcgatggacagtggagcaactccggtctaaaatgt
caacctgtgtattgtggaattccagatcccattgcgaatggtaaagttgaagagccagag
aatagtgtgtttggtactgtcattcactatacgtgtgaagagccatattactacatggaa
catgaagaaggtggggagtatcgatgtgctgcaaatgggagatgggtaaatgaccagctg
ggtattgagcttccaagatgtattccagtctgtggagtacccaccgagccctttcaagtg
cagcagaagatattcggaggacaacctgcaaagattgaaaattttccctggcaagtcttc
tttaatcaccccacagctggtggggctcttattaatgagtactgggtgctgacggccgct
cacgttgtggagaaaaactccgacccttcaatgtatgccgggatcacggctttgagactg
gctgacttggaaaatgcccagaggctctacaccaagcgtgtgattattcatcccggctgg
aaggaagacgatgacctaaacccacggacaaattttgacaatgacattgccctggtccag
ctgaaagaccctgtgaaaatgggacccaagttttcccccatctgcctaccaggcacctcc
tcagagtacaacctctcaccgggtgacatggggctgatctcagggtggggcagaacagaa
aagagactccatgttatcaacctcagaggggcaaaggtaccggtaacctctttagaaacc
tgcaaacaggtgaaagaagagaaccccacagcaaggccagaggactatgttatcactgac
aacatgatctgtgctggtgagaagggtgttgacagctgtaaaggggacagtggaggggct
tttgctttccaggtccccaatgtcaaggccccaaaattctatgtagctgggttggtgtct
tggggaaaaaagtgtggggcctatggggtctacacaaaggtaaagaattatgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaggaaggactaa

KEGG   Mus musculus (mouse): 50908
Entry
50908             CDS       T01002                                 

Gene name
C1s1, AA959438, AI255193, AI327365, C1, C1s, C1sa
Definition
(RefSeq) complement component 1, s subcomponent 1
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50908 (C1s1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    50908 (C1s1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    50908 (C1s1)
   05150 Staphylococcus aureus infection
    50908 (C1s1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50908 (C1s1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50908 (C1s1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50908 (C1s1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     50908 (C1s1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50908 (C1s1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    50908 (C1s1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 EGF hEGF HRM
Other DBs
NCBI-GeneID: 50908
NCBI-ProteinID: NP_001091086
MGI: 1355312
Ensembl: ENSMUSG00000038521
Vega: OTTMUSG00000034941
UniProt: Q8CG14 E9Q6C2 Q14DT6
Position
6; 6 F2
AA seq 694 aa
MGKSPGMWCLVLFSLLASFSAEPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYF
THVDIEPSESCAYDSVQIISGDIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDF
SNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVN
CSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNC
PDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISC
AKKITANSTWQPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKC
QPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQL
GIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAA
HVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQ
LKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLET
CKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVS
WGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagggatgtggtgtttggtcctgttttctcttttggcatcattttct
gctgagcccaccatgcatggggagatcctgtcccctaattatccccaggcgtaccccaat
gacgtcgtgaaatcttgggacattgaagtcccagaggggtttgggattcacctttacttt
acccatgtggacatagagccgtcagagagctgtgcatacgactcagtgcagataatctca
ggagacatcgaggaagggagactctgtggccagaggaccagcaagagccccaactccccc
attatagaagagtttcagttcccatacaataaacttcaggtggtctttacctcagacttc
tccaacgaagaacggtttacgggctttgcagcatactacactgccatagacataaatgaa
tgcacagattttacagatgtcccctgtagccacttctgcaataacttcattggtggatac
ttctgctcctgtcccccagaatacttcctccacgatgacatgaggaattgtggagtcaac
tgtagtggagatgtgttcactgccctgattggggagatctcaagtcccaattatcccaat
ccatacccggagaactcaaggtgtgaataccagattcagctgcaggagggcttccaagtg
gtggtgacgatgcagagagaagattttgatgtggagcccgctgactcagaggggaactgc
cctgacagtttaacttttgcttcaaaaaaccaacagtttggtccttactgtggtaatggg
ttccctggaccgctaactattagaacccagagcaatactctcggcattgtctttcaaact
gacctaatggggcaaaagaagggttggaagcttcgttaccatggagatcccatctcctgt
gccaaaaaaatcactgccaattctacttggcagcccgataaggcaaaatacgtgtttaaa
gatgtggtgaagataacctgtgtggacggatttgaagttgtggagggacatgttagctct
acttcatactattccacttgtcaaagcgatggacagtggagcaactccggtctaaaatgt
caacctgtgtattgtggaattccagatcccattgcgaatggtaaagttgaagagccagag
aatagtgtgtttggtactgttgttcactacacgtgtgaagagccatattactacatggaa
catgaagaaggtggggagtatcgatgtgctgcaaatgggagatgggtaaatgaccagctg
ggtattgagcttccaagatgtattccagcctgtggagtacccaccgagccctttcaagtg
catcagaggatatttggaggacaacctgcaaagattgaaaattttccctggcaagtcttc
tttaatcaccccagagctagtggggctcttattaatgagtactgggtgctgacggctgct
cacgttttggagaaaatctccgaccctttaatgtatgtcgggaccatgtctgtgaggaca
actctcttggaaaatgcccagagactctacagtaaacgtgtctttattcatcccagctgg
aagaaagaagatgacccaaacacacggacaaattttgacaatgacattgccctggtgcag
ctgaaagaccctgtgaaaatgggacccaaagtctcccccatctgcctaccaggcacctcc
tcagagtacaacgtctcaccgggtgacatggggctgatctcagggtggggcagtacagaa
aagaaagtctttgttatcaacctcagaggggcaaaggtaccagtaacctctttagaaacc
tgcaaacaggtgaaagaggagaaccccactgtaaggcctgaggactatgttttcactgac
aacatgatctgtgctggcgagaaaggtgttgacagctgtcacggggacagcggcggggct
tttgctttccaggtccccaatgtcacggtccccaaattctatgtagctggcttggtgtct
tgggggaaaaggtgtgggacttatggggtctacacaaaggtaaagaattacgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaggaaggactaa

DBGET integrated database retrieval system