KEGG   Mus musculus (mouse): 317755
Entry
317755            CDS       T01002                                 

Gene name
Zar1
Definition
(RefSeq) zygote arrest 1
  KO
K18762  zygote arrest protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    317755 (Zar1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     317755 (Zar1)
Motif
Pfam: zf-3CxxC
Other DBs
NCBI-GeneID: 317755
NCBI-ProteinID: NP_777366
MGI: 2180337
Ensembl: ENSMUSG00000063935
Vega: OTTMUSG00000026978
UniProt: Q80SU3
Position
5; 5 C3.2
AA seq 361 aa
MFPASTFHPCPHPYPQATKAGDGWRFGARGCRPAPPSFLPGYRQLMAAEYVDSHQRAQLM
ALLSRMGPRSVSSRDAAVQVNPRRDASVQCSLGRRTLQPAGCRASPDARSGSCQPRGHAG
AGRSPRSWQTVAPFSSVTFCGLSSSLEVAGGRQTPTKGEGSPASSGTREPEPREVAARKA
VPQPRSEEGDVQAAGQAGWEQQPPPEDRNSVAAMQSEPGSEEPCPAAEMAQDPGDSDAPR
DQASPQSTEQDKERLRFQFLEQKYGYYHCKDCKIRWESAYVWCVQGTSKVYFKQFCRVCE
KSYNPYRVEDITCQSCKRTRCACPVRLRHVDPKRPHRQDLCGRCKDKRLSCDSTFSFKYI
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgttcccggcgagcacgttccacccctgcccgcatccttatccgcaggccaccaaagcc
ggggatggctggaggttcggagccaggggctgccgacccgcgcccccctccttcctcccc
ggctacagacagctcatggccgcggagtacgtcgacagccaccagcgggcacagctcatg
gccctgctgtcgcggatgggtccccggtcggtcagcagccgtgacgctgcggtgcaggtg
aacccgcgccgcgacgcctcggtgcagtgttcactcgggcgccgcacgctgcagcctgca
gggtgccgagccagccccgacgcccgatcgggttcctgtcaaccccgtggccacgccggc
gccgggagatccccgcgatcctggcagaccgtagccccgttctcgtccgtgaccttctgt
ggcctctcctcctcactggaggttgcgggaggcaggcagacacccacgaagggagagggg
agcccggcatcctcggggacccgggaaccggagccgagagaggtggccgcgaggaaagcg
gtcccccagccgcgaagcgaggagggcgatgttcaggctgcagggcaggccgggtgggag
cagcagccaccaccggaggaccggaacagtgtggcggcgatgcagtctgagcctgggagc
gaggagccatgtcctgccgcagagatggctcaggaccccggtgattcggatgcccctcga
gaccaggcctccccgcaaagcacggagcaggacaaggagcgcctgcgtttccagttctta
gagcagaagtacggctactatcactgcaaggactgcaaaatccggtgggagagcgcctat
gtgtggtgtgtgcagggcaccagtaaggtgtacttcaaacagttctgccgagtgtgtgag
aaatcctacaacccttacagagtggaggacatcacctgtcaaagttgtaaaagaactaga
tgtgcctgcccagtcagacttcgccacgtggaccctaaacgcccccatcggcaagacttg
tgtgggagatgcaaggacaaacgcctgtcctgcgacagcaccttcagcttcaaatacatc
atttag

DBGET integrated database retrieval system