KEGG   Mus musculus (mouse): 319150
Entry
319150            CDS       T01002                                 

Gene name
H3c2, H3-53, H3c13, H3c14, H3c15, H3c3, H3c4, H3c6, H3c7, Hist1h, Hist1h3b
Definition
(RefSeq) H3 clustered histone 2
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    319150 (H3c2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    319150 (H3c2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319150 (H3c2)
  09165 Substance dependence
   05034 Alcoholism
    319150 (H3c2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319150 (H3c2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319150 (H3c2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319150 (H3c2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319150 (H3c2)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 319150
NCBI-ProteinID: NP_835510
MGI: 2448319
Ensembl: ENSMUSG00000069267
Vega: OTTMUSG00000000587
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
13; 13 A3.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctcgcccgccgcattcgtggggagagggcttaa

DBGET integrated database retrieval system