KEGG   Mus musculus (mouse): 319153Help
Entry
319153            CDS       T01002                                 

Gene name
Hist1h3i, H3-H
Definition
(RefSeq) histone cluster 1, H3i
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    319153 (Hist1h3i)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    319153 (Hist1h3i)
  09165 Substance dependence
   05034 Alcoholism
    319153 (Hist1h3i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319153 (Hist1h3i)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319153 (Hist1h3i)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319153 (Hist1h3i)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319153 (Hist1h3i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 319153
NCBI-ProteinID: NP_835514
MGI: 2448350
Ensembl: ENSMUSG00000101972
Vega: OTTMUSG00000000433
UniProt: P68433
Structure
PDB: 

Position
13; 13 A3.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggctgtcatggctctgcaggaggcctgtgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgtcgcattcgcggggagagggcgtaa

DBGET integrated database retrieval system