KEGG   Mus musculus (mouse): 319162Help
Entry
319162            CDS       T01002                                 

Gene name
H2aw, Hist3h2a
Definition
(RefSeq) H2A.W histone
  KO
K11251  histone H2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    319162 (H2aw)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319162 (H2aw)
  09165 Substance dependence
   05034 Alcoholism
    319162 (H2aw)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319162 (H2aw)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319162 (H2aw)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319162 (H2aw)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319162 (H2aw)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 319162
NCBI-ProteinID: NP_835736
MGI: 2448458
Ensembl: ENSMUSG00000078851
Vega: OTTMUSG00000011797
UniProt: Q8BFU2 A2AB79
Position
11; 11 B1.3
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcgtggcaagcagggcggcaaagctcgtgcaaaagcgaagtctcgttcttcc
cgtgccggcctgcagtttccagtgggccgtgtgcaccgccttctccgtaagggtaattat
tcggagcgggtcggcgctggtgccccggtgtacctggcggctgtgctagaatatctgact
gctgagatcctggaattggctggtaatgcggcccgcgacaataagaagacgcgaatcatc
ccgcgccacctgcagttggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctactgcccaagaag
accgagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system