KEGG   Mus musculus (mouse): 319182
Entry
319182            CDS       T01002                                 

Gene name
H2bc9, H2b-221, Hist1h2, Hist1h2bh
Definition
(RefSeq) H2B clustered histone 9
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    319182 (H2bc9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    319182 (H2bc9)
  09165 Substance dependence
   05034 Alcoholism
    319182 (H2bc9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319182 (H2bc9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319182 (H2bc9)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    319182 (H2bc9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319182 (H2bc9)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 319182
NCBI-ProteinID: NP_835504
MGI: 2448387
Ensembl: ENSMUSG00000114456
Vega: OTTMUSG00000000571
UniProt: Q64478
Position
13; 13 A3.1
AA seq 126 aa
MPEPAKSAPAPKKGSKKALTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcccgccaagtccgctcctgccccgaagaagggctccaagaaggccctgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaagccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system