KEGG   Mus musculus (mouse): 319186Help
Entry
319186            CDS       T01002                                 

Gene name
Hist1h2bm, H2b-291b
Definition
(RefSeq) histone cluster 1, H2bm
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    319186 (Hist1h2bm)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    319186 (Hist1h2bm)
  09165 Substance dependence
   05034 Alcoholism
    319186 (Hist1h2bm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319186 (Hist1h2bm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    319186 (Hist1h2bm)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319186 (Hist1h2bm)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319186 (Hist1h2bm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 319186
NCBI-ProteinID: NP_835507
MGI: 2448404
Ensembl: ENSMUSG00000114279
Vega: OTTMUSG00000000432
UniProt: P10854 B2RTK3
Position
13; 13 A3.1
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccaacgaagtccgctcccgccccgaagaagggctccaagaaggccgtcacc
aaggcccagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctaaagcaagtgcaccccgacaccggcatctcctccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcaggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system