KEGG   Mus musculus (mouse): 319259
Entry
319259            CDS       T01002                                 

Symbol
Bricd5, 9930021D14Rik
Name
(RefSeq) BRICHOS domain containing 5
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BRICHOS
Other DBs
NCBI-GeneID: 319259
NCBI-ProteinID: NP_783613
MGI: 2441766
Ensembl: ENSMUSG00000045744
UniProt: Q8BV89
Position
17; 17 A3.3
AA seq 174 aa
MYSSPKPLLQMLRKTFPSSRVPWPNQTTLVDVAQNMATIVVTPFQSNHSWAVLFDGQNGY
ICYRPAEHQACFLRLMEAQDWETLQLLLNTSRAQESHVPGRDTHYAQELLAVLGGHTVDP
TQVGVSVQHLCADTPIYWTQWAEGPQRQRLIYLCIDICFPSNICVSVCFYYLPD
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtacagctctcccaagccgttgctgcagatgctccgaaagaccttcccgagctccagg
gtaccctggcccaaccaaactactctagtggatgtggcccagaacatggcaaccatcgtg
gtgactccgtttcagagcaaccacagctgggctgtgctgtttgacgggcagaacggctac
atctgttaccgccctgcagagcaccaagcctgcttcctccgtctgatggaagcccaagat
tgggagaccctgcagctgctgctgaacacttccagggcccaagagtcacatgtacctggc
cgggatacccactatgcccaggagctgctggcagttttggggggccatactgtggaccct
acccaagtgggagtttcagtgcaacacctttgtgcagacactcccatctactggacccaa
tgggcagaagggccccagagacagcggctgatctacctctgcattgacatctgcttcccg
agcaacatctgtgtgtctgtctgcttttattacctcccagactaa

DBGET integrated database retrieval system