KEGG   Mus musculus (mouse): 319266Help
Entry
319266            CDS       T01002                                 

Gene name
A130010J15Rik
Definition
(RefSeq) RIKEN cDNA A130010J15 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4504
Motif
Other DBs
NCBI-GeneID: 319266
NCBI-ProteinID: NP_001153831
MGI: 2441776
Ensembl: ENSMUSG00000079144
Vega: OTTMUSG00000020793
UniProt: Q9DAE8
Position
1; 1 H6
AA seq 263 aa AA seqDB search
MSTPSPQLLVAAAQQTLGMGKRKCPPRATCLHLAGEVLAVARGLKPAVLYDCNSAGVLAL
QSYLEELQGLGFLEPGLHILEIGENNFIVSPEYACQHLEQTLLGTVAFVDVSRSQPHPSV
RSVDQLPDLKSLIADVITRFRGLKKDVSQGVSYTRLHSSDWNLCTVFGILLGYPVSYTFD
LNREDDNCLTMTPLRVFTARISWLPGQPSILLYSFSVPESLFPALKNFLSAWEKELRTRF
RAQNAFADLSISSEVVTLPAVAL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaccaagccctcagctgctggtggcagctgctcagcagactctgggcatgggc
aagagaaaatgcccacctcgagctacctgccttcacctggcaggagaggtgctggctgtg
gcccgcgggctgaagccagctgtactctatgattgcaactctgcaggagtattggcgctc
caaagttatctggaggaactacaggggctgggcttcctggagccaggacttcacattctt
gagattggagagaataactttattgtcagtcctgagtatgcctgtcagcatttggaacag
acactgcttggtactgtagctttcgtggacgtttcccgctcccaacctcatccttctgtc
cggtcggtggaccagctcccggacttgaaatctctcatagctgacgtcatcacacgtttt
cgaggacttaagaaagatgtgtctcagggagtctcctacaccaggctacattcctcagac
tggaatctctgcactgtatttgggatactcctgggatatccagtctcttacacatttgac
ctgaaccgtgaagatgacaactgcttaaccatgactcccctgcgggtgtttactgcccgg
atttcgtggctgcctggtcaaccatcaattctgctgtactcctttagtgttccagagagt
ttgttcccagccctgaaaaactttctaagtgcctgggagaaggaactcagaacccgattt
agggctcagaatgcctttgctgacctcagcatctcctctgaggtggtcacacttcctgct
gtggccctctga

DBGET integrated database retrieval system