KEGG   Mus musculus (mouse): 319480
Entry
319480            CDS       T01002                                 

Gene name
Itga11, 4732459H24Rik
Definition
(RefSeq) integrin alpha 11
  KO
K06587  integrin alpha 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    319480 (Itga11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    319480 (Itga11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    319480 (Itga11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    319480 (Itga11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    319480 (Itga11)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    319480 (Itga11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    319480 (Itga11)
   05414 Dilated cardiomyopathy
    319480 (Itga11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    319480 (Itga11)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   319480 (Itga11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA VWA_2 FG-GAP FG-GAP_2 VCBS Ku_N
Other DBs
NCBI-GeneID: 319480
NCBI-ProteinID: NP_795896
MGI: 2442114
Ensembl: ENSMUSG00000032243
Vega: OTTMUSG00000026249
UniProt: Q8CE84 Q7TQC3 A0A0B4J1F0
Position
9; 9 B
AA seq 1188 aa
MDFPRGLLVAWTLSLWPGFTDTFNMDTRNPRVIAGPSAAFFGYTVQQHDISGKKWLVVGA
PMETNGHQKTGDVYKCPVTQGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGIVQYGEDAVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIRQSEKDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGILLGAVGAYDWNGAVLKETSAGKVIPHRESYLKEFPEELKN
HAAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFSMHNNRSLTIHQALRGEQIGSYF
GSEITSVDVNDDRVTDVLLVGAPMYFSEGRERGKVYVYNLRQNRFVYNGTLKDSHSYQNA
RFGSCIASVQDLNQDSYNDVVVGAPLEDSHRGAIYIFHGFQTNILKKPMQRITASELAPG
LQHFGCSIHGQLDLNEDGLVDLAVGALGNAVVLWARPVVQINASLHFEPSKINIFHKDCK
RNGRDATCLAAFLCFIPIFLAPHFQTATVGIRYNATMDERRYMPRAHLDEGGDQFTNRAV
LLSSGQEHCQRINFHVLDTADYVKPVAFSVEYSLEDPDNGPMLDNGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLGRPAQDCSSYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSAVLNISQSENLQFASLIQKDDSDNSIECVNEERRLHKKVCNVSYPFF
RAKAKVAFRLDFEFSKSVFLHHLQIHLGAGSDSHEQDSTADDNTALLRFHLKYEADVLFT
RSSSLSHFEVKANSSLESYDGIGPPFNCVFKVQNLGFFPIHGVMMKITVPIATRGGNRLL
MLRDFFTDQGNTSCNIWGNSTEYRSTPTEEDLSHAPQRNHSNSDVVSIICNLRLAPSQET
SFYLVGNLWLTSLKALKYRSLKITVNAALQRQFHSPFIFREEDPSRQVTFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSAKRKREPGLGPIPKELK
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggactttcccaggggcctcctggtggcctggaccctcagcctttggccaggattcacg
gacaccttcaatatggataccagaaatccccgggtcattgctggtcccagtgctgccttc
tttggctacacagtacagcagcatgatatcagtggcaagaagtggttggttgtgggtgcc
ccaatggaaaccaatggccatcagaagacaggagacgtatacaaatgtccggtaacccag
ggcaactgcaccaagctcaacctgggcagggtcactctgtccaatgtgtctgagaggaag
gacaacatgcgcctcggcctgagccttgccaccaaccccaaggacaacagcttcctggcc
tgcagccctctctggtcgcacgagtgtggaagctcctactacaccactggcatgtgctca
cgggtcaactccaacttcagattctctaagacggtagctccggcacttcagaggtgccag
acttacatggacatcgtcattgtcttagatggctccaacagcatctacccctgggtggag
gtccaacacttcctcatcaatatcctcaaaaagttctacattggccccggccagatccag
gtcggaatagtccagtatggagaagatgccgtccatgagttccaccttaatgactacagg
tctgtaaaagatgtggtggaagccgccagccacattgagcagagaggagggacagagacc
cgcacggcatttggcattgaatttgcacgctcggaggctttccagaagggtggaagaaaa
ggggccaagaaagtgatgattgtcatcacggacggggaatcccacgacagcccagacctg
gagaaggtgatccggcagagcgagaaggacaacgtgaccagatacgctgtggccgttttg
ggctactacaaccgcagggggatcaatccagagacttttctaaatgaaatcaaatacatc
gccagcgaccctgacgacaagcacttcttcaacgtcacagatgaggcggccctgaaggac
attgttgatgcccttggggacaggatcttcagcttggaaggcaccaacaagaatgagacc
tcttttgggctggagatgtcgcagactggcttttcttcacatgtggtagaggatgggatc
ctgctgggagctgtgggagcctatgactggaacggggcggtgctgaaggagacaagtgct
ggcaaggtgattcctcaccgagagtcctaccttaaggagtttccagaggagctgaagaac
catgcagcatacctagggtacacggtgacgtcggttgtgtcctccaggcaggggcgggtg
tatgtggctggagcccccagattcaaccatactggcaaggtcattctattcagcatgcac
aacaaccggagcctcaccatccaccaggctcttcggggcgagcagataggctcctacttt
gggagtgagattacctcagtggacgtcaatgatgacagagtgacagatgtgctgctggtg
ggtgcacccatgtacttcagcgagggccgagagcgaggcaaggtgtatgtctacaacctg
agacagaaccggtttgtttataatggcactctgaaggattcccacagctaccagaacgcc
cggttcgggtcctgcatcgcctctgttcaagacctcaaccaagattcctacaatgatgtg
gtggtgggggcccctctggaggacagccacagaggggccatctacatcttccatggcttc
caaaccaatatcctgaagaagcccatgcagagaataacagcctcggagctggctcctggc
ctgcagcattttggctgcagcatccacggacaactggacctcaatgaggatgggcttgtg
gacctagcagtgggcgccctgggcaacgctgtggttttgtgggcccgccctgtagttcaa
atcaacgccagcctccactttgagccttccaagatcaacatcttccacaaggactgcaag
cgcaatggcagggatgccacctgcctggccgccttcctctgcttcatacccatcttcctg
gcaccccacttccaaacagcaaccgtcggcatcaggtacaatgcaaccatggatgagagg
cggtatatgccgcgggcacatctggacgagggcggagaccagttcaccaacagagccgtc
ctgctctcctctggccaggaacactgtcaaaggatcaacttccatgtcctggacactgca
gactacgtgaagccagtggccttctccgtggagtactccctagaggaccctgacaacggc
cccatgctggacaacggctggcccactacgctcagagtgtcggtgcccttctggaatggc
tgtaatgaggatgaacactgtgtccctgaccttgtactggatgctcggagtgacctgccc
actgccatggagtactgccagcgggtgctggggaggccggcgcaggactgctccagctac
accctgtccttcgacaccactgtcttcatcatagagagcacgcgccgccgggtggcagtg
gaggccacgctggagaacagaggagagaatgcttacagcgccgtcctcaacatctcccag
tcagagaaccttcagtttgccagcctgatccagaaggatgactcagacaacagcatcgag
tgtgtgaacgaggagaggcggcttcacaagaaagtctgcaacgtcagctaccccttcttc
agagccaaggccaaggtggctttccgtctggatttcgagttcagcaagtctgtgtttctg
caccatcttcagatccatctgggtgccggcagtgacagtcacgagcaagacagcaccgca
gacgataacacggccctcctgcgcttccacctcaaatatgaagcagacgtcctctttacc
agaagcagcagcctgagccacttcgaggtcaaggcaaacagctcacttgagagctatgat
ggcatcggacctccgttcaactgtgttttcaaggtgcagaacctgggctttttccccatc
cacggggtgatgatgaagatcactgtgcccatcgccaccaggggtggcaaccgcctgctg
atgttgagggacttcttcaccgaccagggcaacacatcctgtaacatctgggggaacagc
acagagtacaggagtaccccaactgaggaagatctgagccatgccccacagaggaatcac
agcaactccgacgtggtctccatcatctgcaacctgaggctggcccccagccaggagacc
agcttctacctggtgggaaacctgtggctgacatctctgaaagcactcaagtacaggtct
ctgaagatcacagtcaacgccgccttgcagaggcagttccacagccccttcatcttccga
gaggaagaccctagccgccaggtcacatttgagatctccaagcaagaagactggcaggtc
cccatctggatcatcgtgggcagcactctggggggcctcttgctgctggccctgctggtc
ctggcactgtggaagctcggtttttttaaaagtgccaagcgcaagagggaacctggccta
ggccccatccccaaagagctcaagtga

DBGET integrated database retrieval system