KEGG   Mus musculus (mouse): 319504
Entry
319504            CDS       T01002                                 

Symbol
Nrcam, Bravo, C030017F07Rik, C130076O07Rik, mKIAA0343
Name
(RefSeq) neuronal cell adhesion molecule
  KO
K06756  neuronal cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    319504 (Nrcam)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY C2-set_2 Ig_C17orf99 Ig_5 Pur_ac_phosph_N Ig_4 SIT fn3_2
Other DBs
NCBI-GeneID: 319504
NCBI-ProteinID: NP_795904
MGI: 104750
Ensembl: ENSMUSG00000020598
UniProt: Q810U4 Q6QRP1
Position
12:44375568..44651977
AA seq 1256 aa
MQLKIMPKKKHLSAGGVPLILFLCQMISALDVPLDLVQPPTITQQSPKDYIIDPRENIVI
QCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYEGVYQCTAR
NERGAAVSNNIVVRPSRSPLWTKERLEPIVLQNGQSLVLPCRPPIGLPPAIIFWMDNSFQ
RLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISLKVISVDELND
TIAANLSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGNVLSLECIAEGLPTPIIYWIK
EDGMLPANRTFYRNFKKTLQITHVSEADSGNYQCIAKNALGAVHHTISVTVKAAPYWIVA
PQNLVLSPGENGTLICRANGNPKPRISWLTNGVPIEIALDDPSRKIDGDTIIFSNVQESS
SAVYQCNASNKYGYLLANAFVNVLAEPPRILTSANTLYQVIANRPALLDCAFFGSPMPTI
EWFKGTKGSALHEDIYVLHDNGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPT
RIIKQPEYAVVQRGSKVSFECRVKHDHTLIPTIMWLKDNGELPNDERFSTDKDHLVVSDV
KDDDGGTYTCTANTTLDSASASAVLRVVAPTPTPAPIYDVPNPPFDLELTNQLDKSVQLT
WTPGDDNNSPITKFIIEYEDAMHDAGLWRHQAEVSGTQTTAQLKLSPYVNYSFRVMAENS
IGRSMPSEASEQYLTKAAEPDQNPMAVEGLGTEPDNLVITWKPLNGFQSNGPGLQYKVSW
RQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVGFAPEPAAVMGHSGEDLPM
VAPGNVRVSVVNSTLAEVHWDPVPPKSVRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTF
QGTKTHGMLPGLQPYSHYALNVRVVNGKGEGPASTDRGFHTPEGVPSAPSSLKIVNPTLD
SLTLEWDPPSHPNGILTEYILQYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKF
YFYAQTSVGPGSQITEEAITTVDEAGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMP
GTAYKVRVGAEGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVC
FIRRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKK
EDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgcagcttaaaataatgccgaagaagaagcacttatctgcaggcggagtgcccctgatt
ctcttcctgtgccagatgatcagcgcgctggatgttcctctcgatctggtacaacctcca
accatcactcaacagtcaccaaaagactacatcattgaccctcgggagaatattgtaatc
cagtgtgaggccaaagggaaacctcccccaagcttttcctggactcgtaatggaactcac
tttgacatagacaaggaccctctggtcaccatgaagcctggctcaggaacccttgtcatc
aacatcatgagtgaggggaaggcagagacctatgaaggagtctaccagtgcactgcaagg
aacgagcgtggagctgccgtctccaataacattgttgtccgcccatctaggtcacccttg
tggaccaaggaaagacttgaacctatagtactccagaatgggcagtcattagtacttcca
tgtaggcctccgattggattacctccggccataatattttggatggataattcctttcag
agacttccacagagtgagcgggtttcccaaggcctaaatggagacctttacttctccaat
gtcctcccagaggacacccgtgaggactatatctgctatgccagatttaatcacactcaa
accatccagcagaagcagcctatttctttgaaggtgatttcagtggatgaattgaatgac
actatagctgctaatttgagtgacactgagttttatggtgctaaatctagtaaagagagg
cccccaacgtttctaactccagagggcaatgaaagccacaaagaggaattaagaggaaac
gtgctttcgctggagtgcattgcggaaggcctacctactccaattatttactggatcaaa
gaagacggaatgcttcccgccaaccggacattttatcggaactttaagaaaaccctgcag
atcactcatgtttccgaagccgactctggaaattatcagtgcatagcaaaaaacgcatta
ggagccgtccatcacaccatttctgtcactgttaaagcggctccctactggatcgtggca
cctcaaaacctcgtgctttccccgggagagaatgggaccctcatctgcagagctaatggc
aacccgaaacccagaattagctggttaacaaatggagtcccaatagaaattgctctcgat
gaccccagcagaaaaatagatggcgataccattatattttcaaatgttcaagaaagctca
agtgcggtttatcagtgcaatgcctctaacaaatatggatatttactagcaaatgcattt
gtaaatgttctcgctgaaccacctcggattctcacatcagcaaacacactgtaccaggtc
attgcaaacaggcctgctttgctagattgtgccttctttggatctcctatgcctaccatt
gagtggtttaaaggcactaaaggaagcgctcttcatgaagacatttatgttttgcatgat
aatggaacattagaaattcccgtggcccaaaaggatagtacagggacgtatacttgtgtc
gcacggaataaactagggatggcaaagaatgaagttcacttggaaatcaaagatccaacc
aggatcattaaacaacctgagtatgcagtcgtccagagggggagcaaggtgtcctttgaa
tgcagagtgaaacatgaccacaccttaatccccaccattatgtggctgaaggacaatgga
gagctgcccaatgatgaaaggttctccactgacaaggatcatctggtggtatctgatgta
aaggatgacgatggcggaacctacacgtgtacggccaacacaacgctggacagtgcttcg
gccagcgctgtgctcagggttgtcgctcctactccaactccagcccccatttacgatgtc
ccgaatcctccctttgatttagaattgaccaatcaacttgacaaaagtgttcagctgaca
tggaccccaggcgacgacaacaatagccccattacaaaattcatcattgagtatgaagat
gcaatgcatgatgcagggctgtggcgccaccaggctgaagtttctggaacacagaccaca
gcccaactgaagctgtctccctatgtgaactactccttccgtgtcatggcagagaacagc
attgggagaagtatgccgagcgaggcatccgagcagtatcttacaaaagccgcagaacca
gatcagaatcccatggctgtggaaggactagggacagagccggacaacttggtgattaca
tggaagcccctgaatggttttcaatcgaatgggcctggcctccagtacaaagtgagctgg
cgccagaaagatggtgacgatgagtggacgtctgtggttgtggccaatgtatccaaatac
attgtttctggcacaccaacctttgtcccatacctgataaaagttcaagctctgaatgat
gtggggtttgcaccagagccagctgcagtcatggggcattctggagaagaccttccaatg
gtggctcctggaaatgttcgcgtcagcgtggtgaacagtacgctggcagaggtgcactgg
gacccagttcctcccaagagtgtccgaggacacttacaaggctaccggatttactactgg
aagacccagagctcctctaaaagaaacaggcgccacattgagaagaagatcctcaccttc
cagggcaccaagactcacggcatgctgccagggctgcagccatacagtcactatgccctc
aacgtccgagtggtcaacgggaaaggggagggcccagccagcacggacagaggcttccat
acaccggagggagtccctagtgctccctcatctttgaaaattgttaatcccacactggac
tccctcactttggaatgggaccccccaagccacccaaatggcatcctgactgagtacatc
ttacaatatcagccaattaacagcacacatgagctaggccctctggtagatttaaaaatt
cctgccaacaagacccgctggactttgaaaaatttaaatttcagcactcggtacaagttc
tatttctatgcacagacatcagtggggccaggcagtcagatcacagaggaagcgataacg
actgtggacgaagctggtattcctccacctgatgtaggtgcaggcaaaggcaaagaagaa
tggaggaaagaaattgtaaatggttctcgaagcttctttgggttaaagggtctaatgcca
ggaacagcatacaaagttcgagttggtgctgagggggactctggttttgtgagttcagag
gatgtgtttgagacaggaccagcaatggcaagccggcaagtggatatcgcgacccaaggc
tggttcataggtctaatgtgcgctgttgctctcctcatcttaattttgctgattgtttgc
ttcatcagaagaaacaaaggtggtaaatacccagttaaagaaaaggaggatgctcatgca
gaccctgaaatccagcccatgaaggaagatgatgggacgtttggagaatacagtgatgca
gaagatcacaagcctttgaaaaaaggaagtcgaacaccttcagacaggactgtgaaaaaa
gaagatagcgatgatagtctggttgactatggagagggggtgaacggccaattcaacgag
gatggctcctttattggccaatacagtggtaagaaagagaaagagccagcagagggaaat
gaaagctcagaggccccttctcctgtcaacgcaatgaactcctttgtttaa

DBGET integrated database retrieval system