KEGG   Mus musculus (mouse): 319554
Entry
319554            CDS       T01002                                 

Gene name
Idi1, 4832416K17Rik, IPPI1
Definition
(RefSeq) isopentenyl-diphosphate delta isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
mmu_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    319554 (Idi1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     319554 (Idi1)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 319554
NCBI-ProteinID: NP_663335
MGI: 2442264
Ensembl: ENSMUSG00000058258
Vega: OTTMUSG00000040098
UniProt: P58044 G3XA48
Position
13; 13 A1
AA seq 283 aa
MWRGRTLARAIGYAVRGRGLEAEHAAERIEVQLSAQLLSTCSRNLCVLGQIRHSVTMPEI
NTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLLHRAFSVFLFNTENK
LLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRAAKRRLKAELGIPLEEVD
LNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPNEIKSYCYVSKEEVREILK
KAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIHRL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtggcgcggacggacactggcgcgagcgattggatatgctgttagagggcggggcctg
gaggcggagcatgctgcggagaggattgaagtacagctctccgcacagcttctcagcacc
tgcagccggaatctctgtgttctaggtcagatcagacattctgtcacaatgcctgaaata
aataccagccatcttgatgaaaaacaggttcagcttctagcggagatgtgtattcttatt
gatgaaaatgacaataaaattggggctgacaccaagaaaaactgtcaccttaatgaaaac
atcgacaaaggattattacatcgagcttttagtgtcttcttgtttaatactgaaaataag
ctcctgttacagcagagatcagatgctaaaattacctttccaggttgtttcaccaatagt
tgctgtagtcatccattaagtaacccaggcgagctggaagagaacaacgccattggtgtg
aagcgagcagcaaagcggcgcttgaaagccgagttgggaatacccttggaagaggttgat
ctaaatgaaatggattatctaacaagaatttactacaaggcccaatctgatggtatctgg
ggtgaacatgaagttgattacattctgtttctgaggaagaatgtaaccttgaatccagat
cccaacgagattaaaagctattgctatgtatcaaaggaagaagtcagagaaattttgaag
aaggcagccagtggtgaaattaagttaactccgtggtttaagataattgcagatactttc
ctcttcaaatggtgggataacttaaaccatttgagtccatttgttgaccatgagaaaata
catagattgtga

DBGET integrated database retrieval system