KEGG   Mus musculus (mouse): 319581Help
Entry
319581            CDS       T01002                                 

Gene name
Xkr5, 5430438H03Rik, XRG5
Definition
(RefSeq) X-linked Kx blood group related 5
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: XK-related DUF2101
Motif
Other DBs
NCBI-GeneID: 319581
NCBI-ProteinID: NP_001106821
MGI: 2442327
Ensembl: ENSMUSG00000039814
Vega: OTTMUSG00000020767
UniProt: Q5GH66
Position
8; 8 A1.3
AA seq 676 aa AA seqDB search
MHAGLLGLSALLQAAEQSARLCSIVFYFATGRLLWGWLALSVLLPGFLVQALSFLWFRAD
GHQGQWWLAVLHLLQLGVWKRHWDSVATALWKGKEAPSWGQLHLQEADLSALRLLEALLQ
TGPHLLLQAYVFLASDFTDIVPGISALLSWSSLSWALVSYNRFLGIMKPGHHTMLWAALL
CQQLWRMGMLGARVLSLVLFCRVYRVWVLVVGGAHWLVMTFWLVAQQSDIVESTCHWRLF
NLLVGAVFILCYINFWDSPSRSRVASFYLVMLLENSILLLLATDFLQGVPGTSLWTVVGV
LSGFLIGCASLVIYYSLLHPKSSDIQQSFMRKCCGPIEDNKPESEPPPRAVDPTGEMPDS
SSWCQEESYELTSLDKAPSPEQNTAEVGLGEQRSGESSFFSHHHWLLLKLALKTGSVSRI
NAALGGDSPGCSCPPLLGSSQHCDLQRKPLFSHQDLPSSPCDPLTLEKGSEYVGAPKAEM
ESLETSSYLSFASELEDNATTQKPPATQEDSPKLAGSKADLAAQGKETEGPLQGKEGQES
TTLYFSAAMDRTTSHQRGSPVVLRISHSETLVESRPGQPALPQAVTKPFPVTVANISPIP
GRNFRPSAELPGRAPDSSECEEWKDAARDPSMQSSLPKMRLKAAEEPCFTSTPKSESIQR
DYSCRDRVRQEMSFFI
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggggctcctggggctctctgccctgctgcaggcggccgagcaaagcgcgcgc
ctctgctccatagttttctactttgccacgggtcgtctcctctgggggtggctggccctt
tctgtcctcctgcccggcttcttggtccaggccctgagctttctgtggttccgagcagat
gggcatcagggtcagtggtggctggcggtactgcatcttctgcaacttggcgtctggaag
cggcactgggactctgtggcaacggctctgtggaagggaaaggaggctcccagctgggga
cagctgcacctgcaggaggctgacctgtcagccctacggctcctggaggctctgctgcag
acagggccccacctgctgcttcaggcttacgtgttcctagcctctgacttcacagacatt
gtgccaggaatcagtgccctactctcctggtcttcactgtcctgggctctagtgtcatac
aaccgtttcctgggcatcatgaagccaggccaccataccatgctatgggctgctctcttg
tgccagcagctctggaggatgggcatgctgggtgctcgtgtgctaagcctggttctgttc
tgccgagtttaccgtgtgtgggttttggtggttggaggtgctcactggctagtgatgacc
ttctggctcgtggcccagcagagcgacattgtagagagcacctgccactggaggctgttc
aatctgctggtgggggccgtgttcatcctctgctacatcaatttctgggacagcccttcc
agaagcagggtggccagcttctacttggttatgctgctggagaactccatactcttacta
ctggccactgactttctgcagggagtaccagggaccagcctgtggactgtggtgggagtc
ttgtctggatttctgattgggtgtgcatcgctggttatttattacagcttactacaccct
aagtcctcagacatccagcagagcttcatgaggaaatgctgtggccccatcgaggataac
aaacctgaatcagaacctcctcccagggccgtggatcccacaggggagatgccagacagc
tcaagctggtgccaagaggaaagctatgagctaacaagtctagataaggcccccagccca
gagcagaacactgcagaggtggggctcggggagcagagatctggggagtcctctttcttc
agccaccaccactggctgttgctgaaactcgctctcaagacaggaagtgtatctaggatc
aacgcagccctcggaggtgacagccctggctgctcctgtccccctctgctggggtcgagt
caacactgtgatctgcagaggaaacccctgttttcccatcaagacctcccatcctctccc
tgtgaccctttgaccttggagaaagggtctgagtacgtaggggctccgaaagcagagatg
gagtcattggaaacttcaagctatctctcctttgccagcgagcttgaggacaatgcaaca
acccagaagccaccagctacccaggaggacagtccaaagctggctgggtccaaggctgac
cttgcagctcaggggaaggagacagaaggtcccctgcaggggaaggaaggacaggagagc
acaacactgtatttcagtgccgccatggacagaaccacatcccaccaaagaggcagccca
gtagttctgcggatatcccactcggagactctggtagagagcagacctgggcagcctgcg
ctgcctcaggcagtcactaagccctttcctgttaccgtggccaatattagtcccattcca
ggtagaaacttccgccccagtgcagagcttcctggaagagccccagatagttcagagtgt
gaggagtggaaggacgcggcaagggacccgagtatgcagagctcattgccgaagatgagg
ctgaaggcagctgaagagccctgcttcacatctacccctaagtcggagtccatccaaagg
gactacagctgcagggacagggtgagacaggagatgagctttttcatctga

DBGET integrated database retrieval system