KEGG   Mus musculus (house mouse): 319582
Entry
319582            CDS       T01002                                 
Symbol
Trmt9b, 6430573F11Rik, Kiaa1456, TRM9L
Name
(RefSeq) tRNA methyltransferase 9B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_8 Ubie_methyltran CMAS Methyltransf_9 MetW CheR Anamorsin_N Top1B_N_bact PCMT
Other DBs
NCBI-GeneID: 319582
NCBI-ProteinID: NP_795926
MGI: 2442328
Ensembl: ENSMUSG00000039620
UniProt: Q80WQ4
Position
8:36924643..36981738
AA seq 447 aa
MDPEAVELEKRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPGSLVADIGCGTGKYLK
VNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDAIISIGVIHHFSTKERR
IRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQDVLVPWNRALCSRLLSESHQSWGHHC
EHPRSRGFQGPGSVCGCAVCFKGRCDSKRSHSMDYGSAVARTCCEAISKEGERENGLYSN
FGKSFRSWFFSRSLDESTLRKQIERVRPMKIPEAWANSTVSQQPSRHPSLDLHAPEPFST
KGPNLDEVFVDTSSQRHLGWLRTPGTSDNFSGHKGGGSRRKEGGNFLDITDTGDSVAASN
SSDPSARKILRRVSAFDSNDSNSEDSSFLEAQRDATDSKAFMRYYHVFREGELSSLLQES
VSELQVLSSGNDHGNWCIIAEKKRSWD
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatcctgaagctgtggaactggagaagcgacatgtgcacagtgtgtacgagaacact
gccccctacttcactgacctgcagagcaaagcctggccgcgtgtccgccagttcctgcag
gaccagaagccaggcagcctcgtcgctgacattggttgtggaactggaaagtatcttaaa
gtgaatagccaagtccatactctgggctgtgactactgtgggcctctggtagagattgcc
cggaatagagggtgtgaagtcatggtatgtgacaaccttaatcttccctttagggaccag
ggcttcgatgctatcatctccataggagtcatacatcatttttctacaaaagaaagaaga
attagagcaataaaggaaatggccagggttttagctcccggaggccagttgatgatttat
gtctgggcaatggaacagaagaaccgacgctttgagaaacaggatgtacttgtgccgtgg
aacagggcactctgttcccggctgctgtcagaatcccaccagtcatggggtcatcactgt
gagcatcccaggagccgaggcttccagggccccggttccgtgtgcggctgcgcagtgtgt
tttaagggcagatgtgattccaaacggtcccacagcatggactatgggtctgcggtggcc
agaacctgctgcgaagctatttcaaaggaaggcgagcgagagaacggattgtatagcaat
tttgggaaatcctttcgttcctggtttttctccaggtctttggatgaatcaaccctgagg
aagcaaattgaaagagtcaggcccatgaaaatcccagaggcttgggccaatagcaccgtg
tcccaacagccttccagacaccccagcttagacttgcacgctccggagccattttcaaca
aaaggaccaaacttagatgaggtgttcgtagacacatcttctcaaagacacttgggctgg
ctgagaacacctggcacatcagacaacttcagtggacacaagggaggagggagcaggagg
aaggaggggggcaattttctggacatcactgataccggggacagtgtggctgctagtaac
agcagtgatccttctgccagaaaaatattaaggagggtttctgcattcgactccaacgac
tccaactcagaagactcaagctttttggaagcacaacgggatgccaccgattccaaagcc
ttcatgcgttactaccatgtatttcgggaaggtgagctctccagcctgctgcaggagagt
gtgtctgagctacaggttctgagctccggcaatgaccatggtaactggtgcatcattgca
gagaaaaagaggagctgggattaa

DBGET integrated database retrieval system