KEGG   Mus musculus (house mouse): 319642
Entry
319642            CDS       T01002                                 
Symbol
Rab9b, 9330195C02Rik
Name
(RefSeq) RAB9B, member RAS oncogene family
  KO
K07900  Ras-related protein Rab-9B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05132  Salmonella infection
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    319642 (Rab9b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    319642 (Rab9b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    319642 (Rab9b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    319642 (Rab9b)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    319642 (Rab9b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    319642 (Rab9b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_7 AAA_16
Other DBs
NCBI-GeneID: 319642
NCBI-ProteinID: NP_795945
MGI: 2442454
Ensembl: ENSMUSG00000043463
UniProt: Q8BHH2 Q3KNA5
Position
X:complement(135758896..135769305)
AA seq 201 aa
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPDHFPFV
VLGNKVDKEDRQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE
HCMLGHTIDLNSGSKASSSCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagtgggaaatcccttctcttaaaggtcatcctcttgggtgatggaggagttgggaaa
agctcacttatgaaccgttatgtaaccaacaagttcgactcccaggcttttcacacgata
ggggtagagttcttaaatcgagatctggaggtagatggacgctttgtgaccctccagatc
tgggacactgcggggcaggaacgtttcaagagccttagaacaccattctacaggggagcc
gactgctgcctgctaaccttcagtgtggatgaccggcagagctttgagaaccttggtaac
tggcaaaaagagttcatctactatgcagatgtaaaggacccagatcatttcccctttgtg
gttctgggtaacaaggtagacaaagaggataggcaagtaacgactgaggaggcacaagcc
tggtgcatggagaatggaaattacccttatctagaaacaagtgccaaagatgatactaat
gtgacagtggcctttgaagaagctgttaggcaggtgttagctgtagaggaacagctggaa
cattgtatgttaggtcacaccattgatttgaacagtggctccaaagcaagttcttcttgt
tgttag

DBGET integrated database retrieval system