KEGG   Mus musculus (house mouse): 319653
Entry
319653            CDS       T01002                                 
Symbol
Slc25a40, B230315F11Rik
Name
(RefSeq) solute carrier family 25, member 40
  KO
K15119  solute carrier family 25, member 39/40
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    319653 (Slc25a40)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   319653 (Slc25a40)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 319653
NCBI-ProteinID: NP_001276524
MGI: 2442486
Ensembl: ENSMUSG00000054099
UniProt: Q8BGP6
Position
5:8472730..8525223
AA seq 337 aa
MEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQAQNNPFPKGKCFLYS
NGLMDHMCVCEEESKKAWYKKPGNFRGTLDAFLKILRNEGIKSLWSGLPPTLVMAIPATV
IYFTCYEQLSAFLKTKLGENETRIPIVAGVVARFGAVTVISPLELIRTKVQSKKFSYKEL
YQFVSMRVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLKRWLCEKSGLYEPTFMINF
TSGALSGSFAAVATLPFDVVKTQKQTQLWTNEYCKFPAPLDMSTWTIMKNIVADKGFSGL
FTGLIPRLVKIVPACAIMISSYELGKSFFQKQNVESR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggagcctgaaactgaagggccgccaccaacaatcccagtgactcctcttcagcaaatg
attgcctcctgtactggagctgtactgacatcactaatggtgactcccctggatgttgtt
aaaattcgactccaggcccagaacaacccattccccaaaggaaagtgttttttatacagt
aatggactcatggatcacatgtgtgtctgtgaagaggagagcaagaaagcatggtataag
aagccaggaaacttccgtgggacattggatgcctttttaaaaattcttcgaaatgagggc
ataaaatccctgtggagcggcctccctcctactctagtgatggcaattcctgccacagtt
atttattttacctgctatgaacagttaagtgcttttctgaaaaccaaattaggagaaaat
gaaacccgaataccaatagttgctggggttgtcgccagatttggtgcggtaacagtgatc
agtccattagaattgatcagaactaaggtgcagtctaagaagttttcttacaaggaatta
tatcaatttgtgagcatgagagtgtctgaagatggttggatttccctttggaagggctgg
gctcctacgattcttagagatgtgcctttctcagcaatgtactggtataattatgaaaat
ttaaagaggtggctttgtgagaaatctggtttatatgaaccaacatttatgatcaacttt
acttcaggagcattgtctggttcttttgcagctgttgcaactttaccatttgatgtagta
aaaacacagaaacagacgcaactgtggacgaatgaatattgtaaatttcctgcacctttg
gatatgtcaacctggactataatgaagaacattgttgctgacaaaggattttctgggtta
tttacaggtctaattcctcgattagttaaaattgttcctgcttgtgccattatgatcagt
tcatatgaattaggaaagtcgttcttccagaagcaaaatgttgaaagtcggtaa

DBGET integrated database retrieval system