KEGG   Mus musculus (mouse): 319740
Entry
319740            CDS       T01002                                 

Gene name
Zfyve27, 2210011N02Rik, 9530077C24Rik, AI426636, AI593546, AI835681
Definition
(RefSeq) zinc finger, FYVE domain containing 27
  KO
K19368  protrudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    319740 (Zfyve27)
SSDB
Motif
Pfam: FYVE FYVE_2
Other DBs
NCBI-GeneID: 319740
NCBI-ProteinID: NP_796293
MGI: 1919602
Ensembl: ENSMUSG00000018820
Vega: OTTMUSG00000035213
UniProt: Q3TXX3
Position
19; 19 C3
AA seq 415 aa
MQTSDRDLSGPEASPSGMPEVLSECPPAPTKSAAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQMPLCSLLTCLGLNILFLTLNEGAWYSMGALMISVPALLGYLQEVCRGQLPES
ELMRRKYHSIRQEDLQRVRLSRVHLSRPEAVAEVKSFLIQLEAFLARLCYTCESAYRVLH
WENPVVSSQFYGALLGMVCMLYLLPLCWVLALLNSTLFLGNGDFFRVVCEYRACLQRRMN
PRQEECACESSALQGAGGRGLLDSSPAPTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHL
VVLEDEEGTPCPAEDELTLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCAGCAAT
FSVLKKRRSCSNCGNSFCSRCCSFKVPRSSMGATAPEAQRETVCVCASCNQTLSK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcagacttcggatcgggacctgagtgggccggaggcgagccccagcgggatgcctgag
gttctctctgagtgtccacctgcccctaccaagtcagcagcgtttgatctcttcaacctg
gtcctgtcctacaagaggctggagatctacctggaacccctgaaggatgcaggggacggt
gttcgatacttgctaaggtggcagatgcctttgtgttccttgctgacttgcctgggcctc
aacatcttgttcctcactttgaacgagggtgcgtggtactccatgggtgccttgatgatc
tcggtgcctgccctactgggctaccttcaggaggtgtgccggggacagctgccagagtcg
gagctgatgcggaggaagtaccacagcataaggcaggaagacctgcagagagttcgcctt
tcccgagtgcacctttcccgccctgaggctgttgctgaggtgaagagcttcttgatccaa
ctggaagccttcttggcccgcctgtgctatacctgcgagtcagcctaccgtgtacttcac
tgggagaaccccgtggtgtcctcacagttctatggcgctcttctgggcatggtgtgcatg
ctctacctgctaccgctctgctgggtcctcgccctgttaaatagcacactcttcctggga
aatggggacttcttccgagtggtgtgtgagtacagggcctgcctgcagcggaggatgaac
ccccggcaggaagagtgtgcctgtgagagctcagcactgcagggggccggagggaggggc
ctgctggacagctcgcctgcccccacacccaccgaggacctcacgccaggcagtgtggag
gaagctgaggaggctgagccagatgaggagttcaaagatgcaattgaggagacccacctg
gtggtgctggaggatgaagagggcaccccgtgcccagcagaggatgagctgaccctgcag
gacaatggattcctcagcaagaatgaggtgctgcgcagcaaggtgtcccggcttacagag
cggcttcgcaagcgttacccaaccaataacttcgggaattgtgcaggctgtgccgctacg
ttctccgtgctgaagaagaggcggagctgcagcaactgtgggaacagcttctgctcgcgg
tgttgctccttcaaggtgcccaggtcctctatgggagccacagctcctgaagcccagaga
gagactgtgtgtgtgtgcgcctcctgcaatcagaccctgagcaaatga

DBGET integrated database retrieval system