KEGG   Mus musculus (mouse): 319757Help
Entry
319757            CDS       T01002                                 

Gene name
Smo, E130215L21Rik, Smoh, bnb, smoothened
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04360  Axon guidance
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    319757 (Smo)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    319757 (Smo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    319757 (Smo)
   05205 Proteoglycans in cancer
    319757 (Smo)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    319757 (Smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    319757 (Smo)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  319757 (Smo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 319757
NCBI-ProteinID: NP_795970
MGI: 108075
Ensembl: ENSMUSG00000001761
Vega: OTTMUSG00000013446
UniProt: P56726 Q4VBD5 Q8BJN8
Structure
PDB: 

Position
6 A3.3; 6 12.36 cM
AA seq 793 aa AA seqDB search
MAAGRPVRGPELAPRRLLQLLLLVLLGGPGRGAALSGNVTGPGPHSASGSSRRDVPVTSP
PPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHGKLVLWSGLRNAP
RCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPE
GCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAA
FGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCR
ADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGK
TSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGG
YFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFN
QAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWV
WTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSH
DGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANMWL
VEAEISPELEKRLGRKKKRRKRKKEVCPLRPAPELHHSAPVPATSAVPRLPQLPRQKCLV
AANAWGTGESCRQGAWTLVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTN
LMEAEILDADSDF
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccgctggccgccccgtgcgtgggcccgagctggcgccccggaggctgctgcagttg
ctgctgctggtactgctggggggcccgggccggggggcggccttgagcgggaacgtgacc
gggcctgggcctcacagcgccagcgggagctcgaggagggacgtgccggtgaccagccct
ccgccgccgctgctgagccactgcggccgggccgcccactgcgagcctttgcgctacaac
gtgtgcctgggctcggcgctgccctacggagccaccaccacgctgctggctggggactcg
gactcgcaggaggaagcgcacggcaagctcgtgctctggtccggcctccggaatgccccc
cgctgctgggcagtgatccagcccctgctgtgtgctgtctacatgcccaagtgtgagaat
gaccgagtggagttgcccagccgtaccctctgccaggccacccgaggcccctgtgccatt
gtggagcgggagcgagggtggcctgactttctgcgttgcacaccggaccacttccctgaa
ggctgcccaaacgaggtacaaaacatcaagttcaacagctcaggccaatgtgaagcaccc
ttggtgcgaacagacaaccccaagagctggtatgaggacgtggagggctgtgggattcag
tgtcagaacccgctgttcaccgaggccgagcaccaggacatgcacagctacatcgcagcc
ttcggggcggtcactggtctctgcacgctcttcacactggccacctttgtggctgactgg
cggaactccaatcgctaccctgcggttattctcttctatgtcaatgcgtgtttcttcgtg
ggcagcattggctggctggcccagttcatggatggtgcccgccgagagattgtttgccga
gcagatggcaccatgagatttggggagcccacctccagtgagaccctgtcctgtgtcatc
atctttgtcattgtgtactatgccttgatggctggagtagtctggttcgtggtcctcacc
tatgcctggcacacctccttcaaagccctgggcaccacctaccagcctctctcgggcaag
acatcctatttccacctgctcacgtggtcactcccctttgtcctcacggtggcaatcctg
gctgtggctcaggtagatggagactccgtgagtggcatctgttttgtaggctacaagaac
tatcggtaccgtgctggctttgtcctggccccaattggcctggtgcttattgtgggaggc
tacttcctcatcagaggggtcatgactctgttctccatcaagagcaaccaccctgggctt
ctgagtgagaaggcagccagcaagatcaacgagaccatgctgcgcctgggcatttttggc
ttcctggcctttggctttgtgctcatcaccttcagctgccacttctatgacttcttcaac
caggctgagtgggagcgtagcttccgggactatgtgctatgccaagccaacgtgaccatc
gggctgcctaccaagaagcccattcctgactgtgagatcaagaatcggcccagcctcctg
gtggagaagatcaatctatttgccatgtttggcactggcattgccatgagcacctgggtc
tggaccaaggccaccctgctcatctggaggcgcacctggtgcaggttgactgggcacagt
gatgatgagcccaagagaatcaagaagagcaagatgatcgccaaggccttctctaagcgg
cgtgagctgctgcagaacccgggccaggagctctccttcagcatgcacactgtctcccat
gatggacctgttgcgggtttggcttttgacctcaatgaaccctcagctgacgtctcctct
gcctgggctcagcatgtcaccaagatggtggctcggagaggagccatattgccccaggat
gtgtccgttacccctgtggcaactccagtgccaccagaagaacaagccaacatgtggctg
gttgaggcagagatctccccagagttagagaagcgtttgggccggaagaaaaagcggagg
aagaggaagaaggaggtgtgccccttgaggccagcccctgagcttcaccactctgcccct
gttcctgccaccagtgcagttcctcggctgcctcagctgcctcggcagaagtgcctggta
gctgcaaacgcctggggaacaggggagtcctgccgacagggagcctggactctagtctcc
aaccccttctgcccagagcctagtccccatcaagatccatttctccctggtgcctcagcc
ccccgggtctgggctcagggccgcctccaggggctgggatccattcattcccgcactaac
ctaatggaggctgagatcttggatgcagactcggacttctga

DBGET integrated database retrieval system