KEGG   Mus musculus (mouse): 319765
Entry
319765            CDS       T01002                                 

Symbol
Igf2bp2, C330012H03Rik, IM, IMP, IMP-2, Imp2, Neilsen
Name
(RefSeq) insulin-like growth factor 2 mRNA binding protein 2
  KO
K17392  insulin-like growth factor 2 mRNA-binding protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    319765 (Igf2bp2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  RRM domain-containing proteins
   319765 (Igf2bp2)
SSDB
Motif
Pfam: KH_1 RRM_1 KH_2 KH_4 KH_5 MOEP19 RRM_5
Other DBs
NCBI-GeneID: 319765
NCBI-ProteinID: NP_898850
MGI: 1890358
Ensembl: ENSMUSG00000033581
Vega: OTTMUSG00000025859
UniProt: Q5SF07
Position
16; 16 B1
AA seq 592 aa
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRRIQIRNIPPHLQWEVLDGLLAEYGTVENVEQVNTDTET
AVVNVTYMTREEAKLAIEKLSGHQFEDYSFKISYIPDEEVSSPSPPHRAREQGHGPGSSS
QARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHAT
PEGTSEACRMILEIMQKEADETKLAEEVPLKILAHNGFVGRLIGKEGRNLKKIEHETGTK
ITISSLQDLSIYNPERTITVRGTIEACANAEIEIMKKLREAFENDMLAVNQQANLIPGLN
LSALGIFSTGLSVLPPPAGPRGVPPSPPYHPFATHSGYFSSLYPHHHFGPFPHHHSYPEQ
ETVSLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFK
AQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPR
DQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQRYPQGVAPQRSK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgatgaacaagctgtacattgggaacctgagccccgccgtcaccgccgacgacctccgg
cagctcttcggggacaggaagctgcccctggcgggacaggtcctactcaagtccggctac
gccttcgtggactaccccgaccagaactgggccatccgcgccatcgagaccctctcgggt
aaagtggaattgcatgggaaaatcatggaagttgactactcagtctctaaaaagctaagg
agcagaagaatccagattcggaacatcccgcctcacctgcagtgggaggtgttggatggg
ctgttggctgaatatgggacagtggagaacgtggagcaagtcaacacagatacagaaact
gccgttgtcaacgtcacctatatgacaagagaagaggcaaagctagctattgagaagctc
agtgggcatcagtttgaggactactccttcaagatttcctacatccccgatgaagaggtg
agctctccttcaccccctcatcgtgcccgggaacaaggccacggccccgggagctcttct
caggccagacagattgatttcccgctgcggatcctggtccccacccagtttgttggtgcc
atcatcggaaaggagggcttgaccataaagaacatcactaagcagacccagtcccgggta
gacatccacagaaaggagaactctggggctgcagagaagcctgtcacaatccatgctacc
ccagaagggacatctgaagcatgccgcatgattcttgagattatgcaaaaagaagctgat
gagaccaaactggctgaggaggttcctctgaaaatcctggcccacaatggcttcgttgga
agactgattggcaaagaaggcagaaacctgaagaaaatagaacatgagacagggaccaag
ataaccatctcatccttgcaggatttgagcatttataaccccgagagaaccatcaccgtg
aggggcaccattgaagcctgtgccaatgctgagatagagattatgaagaagctccgagag
gcctttgagaacgacatgctggccgttaaccaacaagccaatctgatcccagggctaaac
ctcagtgcacttggcatcttttcgactggactgtctgtgcttcctccaccagcagggccc
cgtggagttccccccagtcctccctatcacccctttgctacccactccggatacttctcc
agtctgtaccctcatcaccatttcggcccattcccacatcatcactcctacccagagcag
gagactgtaagtctcttcatcccaacccaggctgtgggtgctatcatcgggaagaagggg
gcacacatcaaacagctcgctcgatttgctggtgcctccatcaagattgctccagcagaa
ggtccagatgtcagtgagaggatggtcatcatcactggtcctcctgaagcccagtttaag
gctcagggacggatctttgggaaactgaaggaagaaaacttctttaatcccaaagaagaa
gtgaagctggaggcccacatccgagtcccctcgtcgaccgctggccgggtgattggcaag
ggcgggaaaaccgtgaacgagctgcagaacttgacaagtgcagaagttatcgtgcctcgt
gaccaaacgccagacgagaatgaggaagtgatcgtcagaattatcgggcatttttttgct
agccagactgcacaacgcaagatcagggaaattgtacagcaggtgaagcagcaggagcag
agataccctcagggagtcgccccacagcgcagcaagtga

DBGET integrated database retrieval system