KEGG   Mus musculus (mouse): 319767
Entry
319767            CDS       T01002                                 

Gene name
Atp10b, 5930426O13Rik, 9030605H24Rik
Definition
(RefSeq) ATPase, class V, type 10B
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    319767 (Atp10b)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     319767 (Atp10b)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 319767
NCBI-ProteinID: NP_795973
MGI: 2442688
Ensembl: ENSMUSG00000055415
Vega: OTTMUSG00000005449
UniProt: B1AWN4 Q5DU18
Position
11; 11 A5
AA seq 1474 aa
MTCSLDFSWLRWKWRTQDGFSQSPSETTPLLSPETDRQSHNTAEQRVVYPNNSMCHQDWK
KVCRRYPGNSICTTKYTLLTFLPQNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITIF
PLATVLLIIMVKDGIEDFKRYCFDREMNSASIQIYERKEQRYMLKRWQDVRVGDFVQMQC
NEIVPADILLLFSSDPSGVCHLETANLDGETNLKQRRVVKGFSQPEVQFQPEHFHSTIVC
EKPNNHLSKFKGYMEHPDQTRTGFGSESLLLRGCTIRNTEVAAGIVIYAGHETKAMLNNS
GPRYKRSKIERRINTDIFFCIGLLFLMCLIGAVGHSLWNGTFKEHPPFDVPDADGNFLSL
ALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFLLHNDLDLYDEETDLSIQCRALNI
TEDLGQIQYIFSDKTGTLTENKMVFRRCTIVGSEYCHQENAKRLEMPKELDSDGEEWTQY
QCLSFPPRWAQGSTTMRSQGGAQPLRRCHSARVPIQSHCRQRSVGRWETSQPPVAFSSSI
EKDVTPDKNLLSKVRDAALWLETSDTRPAKPSHSTTASIADFFLALTICNSVMVSTTTEP
RKRVTTPPANKALGTSLEKIQQLFQRLKLLSLSQSFSSTAPSDTDLGESLGPNLPTIDSD
EKDDTSVCSGDCSTDGGYRSSTWEQGDILGSESGTSLEEGLEAPTLSQDEPELCYEAESP
DEAALVHAARAYSFTLVSRTPEQVTVRLPQGICLTFDLLFTLGFDSVRKRMSVVVRHPLT
DEIIVYTKGADSVIMDLLEDPACESNIDVEKKLKRIRARTQKHLDLYARDGLRTLCIAKK
VVDEEDFQRWASFRREAEASLDNREELLMETAQHLENHLTLLGATGIEDRLQEGVPDTIA
ALREAGIQLWVLTGDKQETAVNIAYSCKLLDQTDTVYSINTENQETCESILNCTLEDIKR
FHEPQQPARKLCGHRIPPKMPSVNSGAMAPEIGLVIDGKTLNAIFQGKLENKFLELTQYC
RSVLCCRSTPLQKSMIVKLVRDKLSVMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVM
SSDFAIARFSHLKKLLLVHGHWCYSRLARMVVYYFYKNVCYVNLLFWYQFFCGFSGSTMI
DYWQMIFFNLFFTSLPPIIFGVLDKDVSAETLLALPELYKSGQNSECYNLPTFWVSMADA
FYQSLICFFIPYLTYRGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTVLHGLVLLGSF
LMYFVVSLIYNATCVTCNSPTNPYWVMERQLSDPTFYLICLLTPVVALLPRYFLLSLQGT
YGKSLISKAQKIDKLPIDKRNLEIQNWRSKQRPAPASASASASAPATGTVHTRPPCHPVP
PEAQQNFGASTSKSSGPPRQKHVEDRVLQDPRCSREHSRDDTCTVDTLAKLSSGECLLDP
NRTVAPTAYSRGQKDVSRHSSKGSHRRSQSSLTI
NT seq 4425 nt   +upstreamnt  +downstreamnt
atgacttgctctcttgacttttcttggctccgatggaaatggcgaacccaagatggcttc
tcccaatctccatcagaaaccacaccactgctttctccagagacagacagacagagccac
aacacagcagagcagcgggtcgtataccccaacaacagcatgtgtcaccaggactggaag
aaggtctgcaggaggtacccaggcaacagcatctgtacaaccaagtacactctcctcacc
ttcctgccccagaatctctttgagcagtttcataggtgggccaacctctacttcctgttc
ctggtgattctgaactggatgccctccatggaagtcttccacagggaaatcaccatattt
ccactggccactgtcctgttgatcatcatggtcaaagatggcatagaggacttcaagaga
tattgctttgacagggagatgaatagtgccagcattcaaatatatgaaagaaaagaacaa
cgctacatgctgaagcgctggcaggatgtgcgtgtgggagactttgtccagatgcagtgc
aatgagattgtcccagcagacattctccttctcttctcctcagaccccagtggggtctgc
catctggaaactgccaacttggatggagagaccaacctcaagcagaggcgtgtcgtgaag
ggcttctcacagccggaggtgcagttccaaccagagcacttccacagtaccatcgtgtgt
gaaaagcccaacaaccatctcagcaagtttaagggttatatggagcatcctgatcagacc
aggactggctttggcagcgagagtcttctgctccgaggctgcaccatccgaaacaccgag
gtggcggctggcattgtcatctacgcaggccatgaaacaaaagccatgctgaacaatagt
ggcccccgatacaaacgcagcaaaatcgagcggcgcatcaacacagatatcttcttctgc
atcggcctcctcttcctcatgtgcctcattggagctgtaggccacagcctctggaacggt
acctttaaagaacatcctccctttgacgtgccagatgccgatgggaacttcctctctctt
gcccttggaggcttctatatgttcctcacaatgatcatcttactccaggtgttgatcccg
atctccttgtatgtgtccattgagctggtaaaacttgggcaagtgttcctccttcacaac
gaccttgacctatatgatgaagaaactgatttgtctattcaatgccgagctctaaatatt
acagaggacctgggccagatccagtacatcttctctgacaagacagggaccctgacggaa
aacaagatggtgttcaggcgttgtaccattgtgggcagcgaatattgtcaccaagaaaat
gccaagagactggagatgccaaaggagctggactcagatggtgaggagtggacccagtac
caatgtctgtccttcccacctagatgggcccagggctcaacaacgatgagaagccaagga
ggtgcccagcctctgaggagatgccatagtgcccgggttccaatccagagccactgccga
caaagatctgtggggaggtgggaaacctcacagcctcctgtggccttcagcagctcaata
gaaaaagatgtgactcctgacaaaaacctcctgagcaaagtgagagatgctgccctgtgg
ctagagacctcagataccagacctgccaagccttcgcactccaccactgcctccattgct
gacttctttctcgccctaaccatctgcaactccgtcatggtgtccacaaccactgagccc
agaaagagggttaccactccaccagccaacaaggctctagggacatccttggagaagatt
caacagctcttccaaaggctgaagcttttgagtctcagtcaatcattctcatccacggcc
ccctctgacacagatctaggagagagtctgggacccaacttgcccaccatagactccgat
gagaaagatgacacgtccgtgtgtagcggtgactgttccactgacggtggctaccggagc
agcacatgggagcagggtgacatcctggggtctgaatcaggcacttctctggaggagggg
ctggaggcaccaactctcagccaagatgaaccagagctgtgctacgaggctgaaagccct
gatgaagcagccctagtgcatgctgcccgtgcctacagtttcacactagtgtctaggaca
cctgagcaggtgactgtgcgtctgccccagggcatctgcctcacctttgacctccttttc
acgctgggctttgactctgtccggaagagaatgtcagtagtggtgaggcacccactgact
gatgaaataatcgtctacaccaagggtgctgactcagtcatcatggacctgctggaagat
ccagcctgtgagagtaatattgatgtggaaaagaagctgaagagaatccgagccaggacc
caaaaacatctggacttgtatgcaagagatggccttcgaaccctgtgcatcgctaagaag
gttgtagatgaggaggacttccagaggtgggccagcttccgtcgtgaggctgaagcatcc
cttgacaaccgagaggagcttctgatggagacagcccagcacctggagaatcacctcact
ttacttggagccactgggattgaagatcgactccaagaaggggttccagataccatcgct
gcactgcgggaggctggaatccagctctgggttttgacaggagataaacaggagacagct
gtcaatatcgcatattcctgcaaactgctggatcagactgacacagtgtactccattaac
acagagaatcaggaaacctgcgagtccatcctcaattgtacattggaagacataaagagg
tttcatgaaccgcagcagccagccagaaaactctgtgggcaccgcatcccacctaagatg
ccatctgttaactcgggagctatggctcctgaaattggactggtcattgatgggaagaca
ctgaatgcaattttccagggaaagctggagaataagttcctggagttgactcagtactgt
cggtctgtcctgtgttgccgctccaccccactgcagaagagtatgattgtcaagctggtg
cgagacaagttgagcgtcatgactctttccataggggatggagccaatgacgtaagcatg
attcaggctgctgacatcggcattggaatatctgggcaggaaggcatgcaggctgtcatg
tccagtgactttgccattgcccgcttcagccacctcaagaagctgctgcttgtgcatggc
cactggtgttactcgcgcctggccaggatggtagtgtattacttctacaagaatgtgtgc
tacgtcaacctgctgttttggtaccagttcttctgtggtttctctggctccaccatgatc
gattattggcagatgatattcttcaatctcttcttcacgtccttgccacccatcatcttt
ggagtcctcgataaagatgtctctgcagaaacactcctggcattgcctgagttatacaag
agtggccagaactctgagtgctacaacctgccaactttctgggtttccatggctgatgca
ttctaccagagcctcatctgtttctttatcccttacctgacctaccgaggttcagacata
gatgtctttacttttggaactccaatcaacaccatctccctcaccaccatcctcttgcac
caggcaatggaaatgaagacatggactgtcctccatggccttgtcctcctgggaagcttc
ttgatgtacttcgtggtttccctaatatacaacgccacttgtgtcacctgcaacagcccc
accaatccctactgggtgatggaaaggcagctctcagaccccacgttctacctcatctgc
ctcctcactccggttgtggctcttctaccaaggtattttctcctatctctacaaggtaca
tatgggaagtctctaatctcaaaagctcagaaaattgacaagctgcccatagacaaaaga
aaccttgaaatccagaactggagaagcaaacagaggcctgcccctgcctctgcttctgct
tctgcctcagctcctgctactggcactgtccacactagacccccatgccatccagtacca
cctgaagcacagcagaactttggagccagtacctcaaagagctctggccctcccagacag
aagcatgtggaagaccgggttctccaggatccgagatgcagcagagagcattccagggat
gacacatgcactgtagatacattagctaaactttcttctggggaatgccttctggatcca
aacaggacagtggctcctacagcctattccaggggtcaaaaggatgtatctcgacactca
agcaaaggcagccatcgcagatctcagagttcactgaccatatga

DBGET integrated database retrieval system