KEGG   Mus musculus (mouse): 319875
Entry
319875            CDS       T01002                                 

Gene name
Tmprss11b, 9930019B18Rik, Tmprs, Tmprss11bnl
Definition
(RefSeq) transmembrane protease, serine 11B
  KO
K09751  transmembrane protease serine 11B [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    319875 (Tmprss11b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     319875 (Tmprss11b)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   319875 (Tmprss11b)
SSDB
Motif
Pfam: Trypsin SEA DUF1986 Trypsin_2 DUF3094
Other DBs
NCBI-GeneID: 319875
NCBI-ProteinID: NP_795998
MGI: 2442893
Ensembl: ENSMUSG00000035861
Vega: OTTMUSG00000035106
UniProt: Q14C59
Position
5; 5 E1
AA seq 416 aa
MYRPVIASRKSIPPWLIILCVLGVLAALGIIIGLLVHFLAVENKIYYYQGGFKVLDIPYD
RNYERETSLESNYLSKILENKMVEAFQNSNIYKQYINSQVITLVPDNNSVTAHIWLVFKD
PWSNKENLRRRIESILRQMLENNPESLTTDPGSLKLTEISKVDAEKIINNRCGRRPRMSA
TYDRITGGSTAHKGEWPWQASLRVNGKHYCGASLIGERFLLTAAHCFQGTNNPKNLTVSF
GTRVTPAYMQHSVQEIIIHEDYVKGEHHDDVAVIKLTEKVSFNNDVHRVCLPESTQIFPP
GEGVVVTGWGSFSYNGKSPLLLQKASIKIIDTNTCNSEEAYGGRIVDTMLCAGYLEGSID
ACQGDSGGPLVHPNSRDIWYLVGIVSWGHECGRVNKPGVYMRVTSYRNWIASKTGI
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtacagaccagtcatagcatcccgcaaatctatcccaccatggctaatcatcctctgt
gtgcttggagtgctggcagcccttgggataattattggactcttagttcactttctggca
gtagaaaacaagatctactactatcaaggtggttttaaagtgctggatattccatatgac
agaaattatgaaagggagacatcactagaaagtaactacctcagtaaaatccttgagaat
aaaatggttgaagcctttcagaattctaacatttacaaacaatatatcaactctcaggtc
atcacattggttcctgataacaacagcgtgacagcacatatatggctggtgtttaaggat
ccctggtctaacaaggaaaacctaagaaggagaattgaaagcatcttacgtcagatgctg
gagaacaacccagaatccctgactacagatcctgggtctctgaagctcacggaaatcagt
aaggttgatgctgagaagattatcaacaaccgctgtgggagaagaccaagaatgtctgca
acctacgacagaatcacgggaggttccactgctcacaaaggagagtggccatggcaagcg
agtctcagagtgaatggtaaacactactgtggggcatctctgattggcgaaagatttctg
ctcacagcagctcattgctttcaagggacaaataatccaaaaaacttaactgtcagcttt
ggcactagagtaactccagcctacatgcagcattctgttcaagagattattattcatgaa
gattatgtgaagggggaacatcatgatgacgttgcagttataaagctcactgaaaaagtt
tcattcaataatgatgtgcatcgggtttgtcttccggaatccacccagatttttccacca
ggtgaaggagtcgttgttacaggatggggatcattttcttacaatggtaaatccccactg
ttacttcagaaagcatccattaaaatcattgacacaaatacttgcaattcagaagaagct
tatggaggcaggatagtggacacaatgctctgtgctggctacttggaaggcagtatcgat
gcttgccagggtgactctggaggaccactagttcatcccaattctcgagatatttggtac
cttgttgggatagtgagctgggggcatgaatgtggcagagtcaacaagccaggggtctat
atgagagtaacttcctaccgtaactggattgcctccaagactggtatctag

DBGET integrated database retrieval system