KEGG   Mus musculus (mouse): 319885
Entry
319885            CDS       T01002                                 

Gene name
Zcchc7, 4930572I07Rik, D4Wsu132e
Definition
(RefSeq) zinc finger, CCHC domain containing 7
  KO
K12597  protein AIR1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    319885 (Zcchc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    319885 (Zcchc7)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    319885 (Zcchc7)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     319885 (Zcchc7)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    319885 (Zcchc7)
SSDB
Motif
Pfam: zf-CCHC
Other DBs
NCBI-GeneID: 319885
NCBI-ProteinID: NP_613056
MGI: 2442912
Ensembl: ENSMUSG00000035649
Vega: OTTMUSG00000007140
UniProt: B1AX39
Position
4 B1; 4 23.57 cM
AA seq 541 aa
MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCEN
SETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAEEKTQSPAT
SHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESWMLLGSEE
DGKDNDILLNLVGCETAGAEDDVNWFISDKDIEAKIDNNRSSGRWNNRYYSVNKNVTCRN
CDKRGHLSKNCPLPQKVRACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKR
CDRCDMIGHHADACPEIWRQYHLTTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGHECTE
RRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKDLKKNGDFPRQFKRPHVEETDKRRH
HDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCA
NNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKSTEDGSHDDLFLIKQKKKKPKPSG
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtttggtggctatgagactatagaagcatttgaagatgatctttatcgtgatgattca
tctagtgaactgagtgttgatagtgaggtggaatttcagctctacagccaagtccattat
gcccagagtatacataatgccaacaaggaggaaggatatgaggaaaagaactgtgagaat
tcggaaacagtgagtagtcaaccaaatcagaagaacttaatcgtcctttcagatagtgag
gtcatccagctatctgatacatcagaggtcatcacattatctgatgaagatagtatttat
agatgtaaaagaaaaaatattgaagtccaagcggaagaaaagacccagagccctgctact
tctcattctaataaagtggctcagaaatgcaagaggaataataagaagcctaaacctgaa
gagaggccaggtgtgatccgagaggtcatgatcatagaggtcagttcaaatgaggaggaa
gaaagtaccacttcagagaacgaaaatgtggaaagctggatgctcctggggtctgaggaa
gatggtaaagacaatgacatccttctcaacttggtggggtgtgagaccgctggtgctgaa
gatgatgtaaattggttcatcagtgacaaagacatcgaggccaagatagataataacaga
tcatctggaaggtggaacaaccgatactattcagtcaacaaaaatgtcacctgtagaaat
tgtgataaacgtggccatttgtcaaaaaactgccccttaccacaaaaagtccgggcctgc
tgcctctgctcagagagaggacatctccagtatggctgtccagcccgttactgcttagac
tgctctttgcccatgtcttccaaccacagatgttttgaaagattgtcctggagaaaacga
tgtgaccgatgtgatatgataggccaccatgctgacgcttgcccagaaatctggaggcag
tatcacctaacgaccaaacctggaccaccaaaaaagccaaagaccccttctggacaatca
gcgttagtgtattgctacaactgtgcacagaaaggccattatggacatgaatgtacagag
agacgaatgtttaaccagacgtttccaacatctccattcatatattgctatgatggcaaa
tatgacatccagcaaagggatcggagaataaagcgaaaagtcaaagatctcaagaaaaat
ggagactttccaaggcagttcaaaagaccacatgtagaagagacagataagaggcgccac
cacgatatgagaaaaagccgttccccaagaaaatacaggaggtggcctcgagaaaataaa
gaaacacagaaagaaaagaccaggagtagagaaggcaagacgcacaggaggggtcaccag
cctcggggtgaggatgaagacttccccaggggctcaaaacccaacgcctctggctgcgct
aacaaccagaagccttctaagtccctccaccatgcatcccattaccacaggctgagagaa
gagcggcttctcagggagagcaagcggagcaagccaaagaaaaggaagagtacagaggac
ggcagccatgatgatttgtttcttattaagcaaaagaagaagaagcctaagccgagtggt
ctctga

DBGET integrated database retrieval system