KEGG   Mus musculus (mouse): 319909
Entry
319909            CDS       T01002                                 

Symbol
Ism1, 5430433G21Rik, Ism
Name
(RefSeq) isthmin 1, angiogenesis inhibitor
  KO
K24435  isthmin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    319909 (Ism1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Other thrombospondin domain-containing proteins
   319909 (Ism1)
SSDB
Motif
Pfam: AMOP TSP_1 TSP1_spondin TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 319909
NCBI-ProteinID: NP_001263418
MGI: 2442963
Ensembl: ENSMUSG00000074766
Vega: OTTMUSG00000015588
UniProt: V9GXR4
Position
2; 2 F3
AA seq 461 aa
MVRLAAELLLLLGLLLLTLHITVLRGSGASDRQDAAAGNVSGSQLQNNLNLESDSTSETS
FPLSKEAPEEHQVVHQPFPRQRFPPETGHPSLQRDGPRSFLLDLPNFPDLSKADINGQNP
NIQVTIEVVDGPDSEAEKDQHPENKPSWSLPAPDWRAWWQRSLSLARTNSGDQDDKYDST
SDDSNFLSVPRGWDRPAPGHRTFETKEQPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRS
CGYACIATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDMDSCERWMSC
KSEFLKKYMHKVINDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKDASGPKEKLEIYKP
TARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDVLPW
IICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggtgcgcctggctgcggaactgctcctgctgctggggctactgctgctcacgctgcac
atcacggttctgcgcggatccggagcctccgaccggcaggacgcggccgccggcaacgtc
agcgggtcccagttgcagaataacctcaacctggagagtgactccacgtcagaaaccagc
tttcctctgtccaaagaagccccggaggagcaccaggttgtccaccaacccttccccaga
cagcgattccctccagagactggacatccttcactgcagagagacggccccagatccttt
ctccttgacctaccaaactttccagatctttccaaagctgatatcaatgggcagaatcca
aacattcaggtcaccatagaggtggttgatggccctgactccgaagcagaaaaagatcag
catccagagaataaacccagctggtcgctcccagctcccgactggcgggcctggtggcag
aggtccttgtccttggccaggacaaatagtggggaccaggatgacaagtatgacagtacc
tcagatgacagcaacttcctcagtgttcctagaggatgggaccgtccagccccaggacac
cggacttttgaaaccaaagagcagccagagtatgattccacagacggggagggtgattgg
agtctctggtctgtctgcagcgtcacctgtggaaatggcaaccagaaacggacccgttct
tgtggctatgcatgcattgccacagaatccaggacctgtgaccgtccaaactgcccagga
attgaagatactttcaggacagcggccactgaagtgagtctgcttgcgggaagtgaggag
tttaatgccaccaagttgtttgaagttgacatggacagctgtgagcgatggatgagctgc
aaaagtgagttcttaaagaaatacatgcacaaggtgatcaacgacctgcccagctgcccc
tgctcctaccctactgaggtggcctacagcacagctgacatctttgaccgcatcaagcgc
aaggacttccgatggaaggatgctagtgggcccaaagagaaactagagatctacaagcct
actgctcggtactgcatccgctctatgctgtccctggagagtaccacactggctgcccag
cactgttgctatggtgacaacatgcagctcatcaccaggggcaaaggggcaggcactccc
aatctcatcagcaccgagttctctgctgaactccactacaaagtggatgttctgccctgg
attatctgcaagggtgactggagcagatataatgaggcccggcctcccaataacggacag
aagtgcacagagagcccttctgatgaggactacatcaaacagttccaagaagccagagag
tactaa

DBGET integrated database retrieval system