KEGG   Mus musculus (mouse): 319922
Entry
319922            CDS       T01002                                 

Symbol
Vwc2, A930041G11Rik, B, G11, PSST739, UNQ739, cr, cradin
Name
(RefSeq) von Willebrand factor C domain containing 2
  KO
K24521  brorin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    319922 (Vwc2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Von Willebrand domain-containing proteins
  VWC domain-containing proteins
   319922 (Vwc2)
SSDB
Motif
Pfam: VWC Pacifastin_I
Other DBs
NCBI-GeneID: 319922
NCBI-ProteinID: NP_796007
MGI: 2442987
Ensembl: ENSMUSG00000050830
Vega: OTTMUSG00000005156
UniProt: Q8C8N3
Position
11; 11 A1
AA seq 324 aa
MPSSSAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDSPGRVS
ELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSAKAADWQVRPRGDTPQG
EPPAAAQEAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCT
EEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGKTYQTLEEFVVSPCERCRC
EANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICH
CTYEEGTWRIERQAMCTRHECRQM
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcctagctcctctgcgatggcagttggcgcgctctccagttccctcttggtcacctgc
tgcctgatggtggctctgtgcagtccgagcatcccgctggagaagctggcccaagctcct
gagcaacccggccaggagaagcgcgagcacgcgtctcgggacagcccggggcgggtgagc
gagctcgggcgcgcctcgagggacgagggcagcagtgcccgggactggaagagcaagggc
agccgcgcgctctcgggccgggaggcgtggagcaagcagaagcaggcctgggctgcccag
ggcgggagcgccaaggccgcggactggcaggtccggcctcgcggggataccccacagggg
gagcccccggccgccgcccaggaagctatcagcctggaactcgttcccacaccggagctg
cctgaggaatacgcctacccggactaccgcgggaagggctgtgtggacgagagtggcttc
gtgtatgcgatcggggagaagttcgccccaggtccctcagcctgcccgtgtctgtgtacg
gaggaggggcccctttgcgcacagccagagtgcccacggcttcacccgcgctgcatccac
gtcgacaacagccagtgctgtccgcagtgcaaggagaagaagaactactgcgagttccgg
ggcaagacctaccagactttggaggagtttgtggtgtctccatgtgaacggtgccgctgt
gaagccaatggtgaagtgctgtgcacagtgtcggcgtgtccccagacggaatgtgtggac
cccgtatatgagcctgatcagtgctgcccgatctgcaaaaacggtccaaactgctttgca
gaaaccgctgtaatcccagctggtagagaggtgaagactgacgagtgcaccatatgtcac
tgcacttatgaagagggcacgtggagaattgaacggcaagccatgtgcacgagacatgag
tgcagacaaatgtag

DBGET integrated database retrieval system