KEGG   Mus musculus (house mouse): 319924
Entry
319924            CDS       T01002                                 
Symbol
Apba1, 6430513E09Rik, Lin-10, Mint, Mint1, Urop11, X11, X11alpha
Name
(RefSeq) amyloid beta precursor protein binding family A member 1
  KO
K04531  amyloid beta A4 precursor protein-binding family A member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    319924 (Apba1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    319924 (Apba1)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    319924 (Apba1)
SSDB
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 DUF6288
Other DBs
NCBI-GeneID: 319924
NCBI-ProteinID: NP_796008
MGI: 1860297
Ensembl: ENSMUSG00000024897
UniProt: B2RUJ5
Position
19:23736170..23926961
AA seq 842 aa
MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVVEGQQPSPSPPPPAGHEPEDHRGHPA
PPPPPPPQEEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDES
AYAVQYRPEAEEYTEQAEAEHVEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFH
RAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLH
HYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEA
EQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKE
AIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESS
SIPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDK
TPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQE
PMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESE
DAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCK
DVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLV
GLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGG
IAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPV
YI
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgaaccacttggagggctccgcggaggtggaggtggccgacgaggcgccaggaggggag
gtgaacgagtccgtggaggccgacctggagcaccccgaggtggtggagggacagcagccg
tcgccatcgcccccgccgcccgcaggtcacgagcccgaggaccaccgcgggcatcccgct
ccgccaccgccgccaccaccgcaggaggaggaggaggaagagcgcggcgagtgcctggcg
cgctcggccagcaccgagagcggcttccacaaccacacggacacggccgagggcgacgtg
ctcgccgcggcccgcgacggctacgaggcggagcgcgcgcaggacgccgacgatgagagc
gcctacgccgtgcagtaccggcccgaggccgaggagtacacggagcaggcggaggccgag
cacgtcgaggcggcgcagcggcgcgcgctgcccaaccacctgcacttccactcgctggag
cacgaggaagccatgaacgccgcctactcgggctacgtctacacgcaccggctcttccac
cgcgccgaggacgagccgtacgccgagccctacgccgactacggcggcctccaggagcac
gtgtacgaggagatcggggacgcgcccgagctggaggcgcgcgacggcctgcggctctac
gagcgcgagcgcgacgaggcggccgcctaccgccaggaggccctgggcgcgcggctgcac
cactacgacgagcgctccgacggcgagtccgacagccccgagaaggaggcggagttcgcg
ccctacccgcgcatggacagttatgagcaggaagaggacatcgaccagatcgtggccgag
gtcaagcagagcatgagttcgcagagcctcgacaaggcggccgaagacatgcccgaggcg
gagcaggacctggagcgtgccccgactccgggagggggacaccccgacagtcccgggctg
ccagcacctgccgggcagcagcagcgggtcgtgggaaccccgggaggcagcgaggttggg
cagcggtacagcaaggaaaagagggatgccatctcgctggccatcaaggacatcaaggag
gccattgaagaagtgaaaaccaggaccatccgttcgccttacacccccgacgagcccaaa
gagcccatctgggtcatgcgccaggacattagccccacgagggactgtgacgaccagagg
cccgtggacggagattctccgtctcctggcagttcctcacccctgggtgctgagtcatca
agcataccccttcatcccggcgaccccacggaagcctccacaaataaagagtcaagaaaa
agcttggcttcattcccaacctacgttgaagttcctggaccgtgcgaccctgaagacttg
atcgatggaattatttttgctgccaattaccttggttccactcagctactctcagacaaa
actccctccaaaaatgtacgcatgatgcaggcccaggaagcagtaagccggatcaagacg
gcccagaaattagccaaaagcaggaagaaggctcctgaaggcgaatctcagccaatgact
gaggtggacctgttcatctctacccagaggatcaaagtactgaatgcggatacacaggaa
cctatgatggaccaccctctgaggaccatttcctacatcgcagacattggcaacatcgtc
gtgctgatggcccgcaggcggatgccccgttctaactcccaggaaaatgtggaggcctct
cacccttcccaggatggaaaaagacagtacaagatgatctgccatgtctttgagtctgag
gacgcccagctgatcgcgcagtccataggacaggcattcagtgttgcgtaccaggaattc
ctcagggccaatggcatcaacccagaagacctcagccagaaggaatacagtgacctgctc
aacacccaggacatgtacaacgatgacctgatccacttctccaagtcggaaaactgcaaa
gatgtcttcatagagaagcagaaaggtgagatcctgggagttgtgattgtggagtctggc
tggggatccattctgccaaccgtgatcattgccaacatgatgcacgggggccctgcagag
aagtcggggaagctgaatatcggggaccagatcatgtccatcaacggcaccagcctggtg
ggcctgcctctctctacctgccagagcatcattaagggcttaaagaaccagtcccgagtg
aagctgaatatcgtgaggtgccccccagtgaccacagtgctaataaggaggccggacctt
cgctaccagctgggtttcagcgtacagaatggaattatctgcagcctcatgagaggggga
atcgctgagagaggaggcgtccgcgtgggacatcggatcatcgaaatcaatggccagagt
gtcgtagccacaccacacgagaagatcgtccacatcctctccaatgctgttggggagatc
cacatgaagacaatgccagcagccatgtaccgactgctgacggcccaggagcagcccgtt
tacatctga

DBGET integrated database retrieval system