KEGG   Mus musculus (mouse): 319930Help
Entry
319930            CDS       T01002                                 

Gene name
Ceacam19, C130022P09Rik, CEAL1
Definition
(RefSeq) carcinoembryonic antigen-related cell adhesion molecule 19
  KO
K16825  carcinoembryonic antigen-related cell adhesion molecule 19
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    319930 (Ceacam19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 319930
NCBI-ProteinID: NP_796010
MGI: 2443001
Ensembl: ENSMUSG00000049848
Vega: OTTMUSG00000029715
UniProt: Q3TQ88
Position
7; 7 A3
AA seq 271 aa AA seqDB search
METWTPPGCFSKGLLFSALFLALELPQGSQAALHIEMIPEQPQKNQDLLLSLHGVPSTAQ
DFIWYLGEEASGGTRLFSYIPGLPRPQRDGSAMGQRDIVGFPNGSMLLRNAQPSDSGTYQ
VAATMNPAWTMKAKINVHVAGAREVSSLLPVHAGITVAIIIGSLAIGSLLVCGIAYVLVT
RSRKGRSPRNPATEKPEVNLSPESGDSNIYEVMPSPVFLVSPISDMEQGSPPMSQPPPPP
PASQEPEPEHQHYQDLLNPDPAPYCQLVPTS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggagacctggaccccaccgggctgcttctcaaagggcctcctgttctcagccttgttc
ctggcccttgagctgccccaaggctcacaggcagccctccacatcgagatgatcccagag
cagcctcaaaagaaccaggaccttcttctgtcccttcacggtgttcccagcactgctcag
gatttcatctggtacctgggggaggaggcttctggaggcacaaggctgttctcttatatc
cccggactaccacggccccagagggatggcagtgccatgggacagcgagacattgttggc
ttcccaaatggttccatgctgcttcgaaatgcccaaccttcagatagtggcacctatcag
gtggccgccaccatgaaccctgcctggacaatgaaggccaagattaacgtccatgtagct
ggtgcacgcgaggtctcctcactcctccctgtccatgccgggatcacggtagccatcatc
attgggagtcttgctatcgggtcactacttgtatgtggcattgcctatgtcctggtcact
cgaagccggaagggccggagccccaggaatccagccacagagaagccagaagtgaacctg
agtcctgaatctggtgacagcaacatctatgaagtgatgccatctccagtcttcctggtg
tctcccatcagtgacatggagcaaggaagcccacccatgagtcagcctccaccacctcca
ccagcatctcaggagccagagccagagcaccagcactatcaggacctactaaaccctgac
ccagccccatactgccagctggtgccaacttcctga

DBGET integrated database retrieval system